Clone Name | rbart25f03 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | ZSWM4_MOUSE (Q8C7B8) Zinc finger SWIM domain-containing protein 4 | 31 | 2.4 | 2 | YL111_MIMIV (Q5UPI7) Hypothetical protein L111 | 29 | 6.9 | 3 | HEM6_SOYBN (P35055) Coproporphyrinogen III oxidase, chloroplast ... | 29 | 6.9 | 4 | NAS9_CAEEL (P91137) Zinc metalloproteinase nas-9 precursor (EC 3... | 29 | 9.0 | 5 | HEM6_TOBAC (Q42946) Coproporphyrinogen III oxidase, chloroplast ... | 29 | 9.0 |
---|
>ZSWM4_MOUSE (Q8C7B8) Zinc finger SWIM domain-containing protein 4| Length = 1101 Score = 30.8 bits (68), Expect = 2.4 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = -1 Query: 233 VCIILAPRTKPRSKSEWWVLSGSVDRTPV 147 VC+IL+P KP +S W L G+ D+ V Sbjct: 337 VCVILSPHCKPDERSGWLQLLGTWDKLDV 365
>YL111_MIMIV (Q5UPI7) Hypothetical protein L111| Length = 374 Score = 29.3 bits (64), Expect = 6.9 Identities = 28/93 (30%), Positives = 39/93 (41%), Gaps = 4/93 (4%) Frame = +1 Query: 28 LVWY----IHSKQRFPNHPRISTKLLPRYTGAPHRTAPKIAYIYTGVLSTLPLKTHHSDL 195 LVWY +H P+ R + K + G HR K AYI V+ L H D Sbjct: 175 LVWYKNGLLHRDGDKPSVKRANGKTIWCKNGLKHRDNDKPAYIDNNVIRWLQFGKMHRDN 234 Query: 196 DRGFVRGARIMHTTSSEKYHDNCFSYYKLTNDN 294 D + A + +T + + Y D+ KL DN Sbjct: 235 D----KPAYVSNTGTLKWYVDD-----KLHRDN 258
>HEM6_SOYBN (P35055) Coproporphyrinogen III oxidase, chloroplast precursor (EC| 1.3.3.3) (Coproporphyrinogenase) (Coprogen oxidase) Length = 385 Score = 29.3 bits (64), Expect = 6.9 Identities = 14/38 (36%), Positives = 18/38 (47%) Frame = -1 Query: 251 YFSDDVVCIILAPRTKPRSKSEWWVLSGSVDRTPVYIY 138 YF D AP+ P + +WW G D TP YI+ Sbjct: 192 YFETD------APKDAPGAPRQWW-FGGGTDLTPAYIF 222
>NAS9_CAEEL (P91137) Zinc metalloproteinase nas-9 precursor (EC 3.4.24.21)| (Nematode astacin 9) Length = 546 Score = 28.9 bits (63), Expect = 9.0 Identities = 21/87 (24%), Positives = 36/87 (41%), Gaps = 10/87 (11%) Frame = +1 Query: 43 HSKQRFPNHPRISTKLLPRYTGAPHRTAPKIAYIYTGVLSTLPLKTHHSDLDR------G 204 H +R+P HP+ LP++T P I Y +L +P H L G Sbjct: 106 HFCRRYPGHPKCQRGQLPQFTDVP-TIINTIIYNAGDLLPRVPTLNIHDPLAGLNSELVG 164 Query: 205 FVRGARI----MHTTSSEKYHDNCFSY 273 F++ + + + + HD+C S+ Sbjct: 165 FIKSLQSQFGQLSSQQRNEIHDSCRSF 191
>HEM6_TOBAC (Q42946) Coproporphyrinogen III oxidase, chloroplast precursor (EC| 1.3.3.3) (Coproporphyrinogenase) (Coprogen oxidase) Length = 397 Score = 28.9 bits (63), Expect = 9.0 Identities = 14/38 (36%), Positives = 18/38 (47%) Frame = -1 Query: 251 YFSDDVVCIILAPRTKPRSKSEWWVLSGSVDRTPVYIY 138 YF D AP+ P + +WW G D TP YI+ Sbjct: 204 YFETD------APKDAPGAPRQWW-FGGGTDFTPAYIF 234 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 70,762,444 Number of Sequences: 219361 Number of extensions: 1405718 Number of successful extensions: 3459 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3368 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3456 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3985467738 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)