| Clone Name | rbart25e10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RETO_ESCCA (P30986) Reticuline oxidase precursor (EC 1.21.3.3) (... | 74 | 2e-13 | 2 | RETO_PAPSO (P93479) Reticuline oxidase precursor (EC 1.21.3.3) (... | 72 | 5e-13 | 3 | Y4GI_RHISN (P55465) Hypothetical protein y4gI | 29 | 6.9 | 4 | Y1286_METJA (Q58682) Hypothetical protein MJ1286 | 29 | 6.9 | 5 | MCRA_STRLA (P43485) Mitomycin radical oxidase (EC 1.5.3.-) | 29 | 6.9 |
|---|
>RETO_ESCCA (P30986) Reticuline oxidase precursor (EC 1.21.3.3)| (Berberine-bridge-forming enzyme) (BBE) (Tetrahydroprotoberberine synthase) Length = 538 Score = 73.9 bits (180), Expect = 2e-13 Identities = 36/82 (43%), Positives = 52/82 (63%), Gaps = 5/82 (6%) Frame = -1 Query: 472 LYDFMGQYVSKNPRQAYVNYRDLDIG-----QNVVVDDATTFDSAKVWGEQYFTSNFQRH 308 +Y+FM +VSKNPR YVN+ DLD+G VV++A + ++ WGE YF SN++R Sbjct: 440 VYEFMKPFVSKNPRLGYVNHIDLDLGGIDWGNKTVVNNA--IEISRSWGESYFLSNYERL 497 Query: 307 AAVKAAVDPTDYFRNEQSIPPL 242 K +DP + F + QSIPP+ Sbjct: 498 IRAKTLIDPNNVFNHPQSIPPM 519
>RETO_PAPSO (P93479) Reticuline oxidase precursor (EC 1.21.3.3)| (Berberine-bridge-forming enzyme) (BBE) (Tetrahydroprotoberberine synthase) Length = 535 Score = 72.4 bits (176), Expect = 5e-13 Identities = 33/81 (40%), Positives = 54/81 (66%), Gaps = 3/81 (3%) Frame = -1 Query: 469 YDFMGQYVSKNPRQAYVNYRDLDIGQNVVVDDATTFDSAKV---WGEQYFTSNFQRHAAV 299 YD++ +VSK PR YVN+ DLDIG + ++T ++ ++ WGE+YF+SN++R Sbjct: 445 YDYLEPFVSKEPRVGYVNHIDLDIGGIDWRNKSSTTNAVEIARNWGERYFSSNYERLVKA 504 Query: 298 KAAVDPTDYFRNEQSIPPLVQ 236 K +DP + F + QSIPP+++ Sbjct: 505 KTLIDPNNVFNHPQSIPPMMK 525
>Y4GI_RHISN (P55465) Hypothetical protein y4gI| Length = 909 Score = 28.9 bits (63), Expect = 6.9 Identities = 13/31 (41%), Positives = 18/31 (58%), Gaps = 2/31 (6%) Frame = +1 Query: 16 IDRRVFIHEVTAKLQFWLP--HPTSVALMHE 102 +D R F H+V A + W+P P SV L H+ Sbjct: 138 VDGRHFYHDVKADFENWIPKLSPRSVVLFHD 168
>Y1286_METJA (Q58682) Hypothetical protein MJ1286| Length = 595 Score = 28.9 bits (63), Expect = 6.9 Identities = 16/45 (35%), Positives = 23/45 (51%) Frame = +1 Query: 10 RQIDRRVFIHEVTAKLQFWLPHPTSVALMHELTEAQIALVHPTSV 144 R+I R FI+ V L F+L TS ++H L + +H SV Sbjct: 497 REISARQFIYVVVIYLSFFLYIGTSYIMVHSLLPTLLKNIHGLSV 541
>MCRA_STRLA (P43485) Mitomycin radical oxidase (EC 1.5.3.-)| Length = 447 Score = 28.9 bits (63), Expect = 6.9 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = -1 Query: 334 YFTSNFQRHAAVKAAVDPTDYFRNEQSIPP 245 Y ++F R AVKA DP + FR +IPP Sbjct: 413 YTPADFARLRAVKAQYDPDNMFRVNFNIPP 442 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 63,300,105 Number of Sequences: 219361 Number of extensions: 1205709 Number of successful extensions: 3045 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2992 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3043 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3072927439 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)