| Clone Name | rbart25d05 |
|---|---|
| Clone Library Name | barley_pub |
>COBL6_ARATH (O04500) COBRA-like protein 6 precursor| Length = 454 Score = 28.9 bits (63), Expect = 3.9 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = -1 Query: 142 SVWVYGLQFGPESGPGCCLSLFAYYYGHFV 53 +V VY QF P CC+SL A+YY + V Sbjct: 217 AVCVYS-QFRSSPSPKCCVSLSAFYYQNIV 245
>TRUB_LEGPA (Q5X1C5) tRNA pseudouridine synthase B (EC 5.4.99.-) (tRNA| pseudouridine 55 synthase) (Psi55 synthase) (tRNA-uridine isomerase) (tRNA pseudouridylate synthase) Length = 303 Score = 28.9 bits (63), Expect = 3.9 Identities = 13/38 (34%), Positives = 22/38 (57%) Frame = +1 Query: 52 TQSARNNKQINLNNIQDLTLDQTEARIPKLNTSIRHLT 165 T NN+ L+ +QD+ L Q A + ++ +I+HLT Sbjct: 205 TAGFENNRMYTLDELQDMPLSQRLACLIPIDQAIQHLT 242
>ISPZ_HAEDU (Q7VKZ1) Probable intracellular septation protein| Length = 183 Score = 28.5 bits (62), Expect = 5.2 Identities = 13/39 (33%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Frame = -3 Query: 170 KPVR*RMLVFSLGIRASVWSRVR-SWMLFKFICLLLRAL 57 KPV +L L + VW+R+ W +F IC+L+ + Sbjct: 98 KPVVKMLLAKELSLPTQVWNRLNLGWAIFFIICMLINII 136
>TRUB_LEGPL (Q5WT38) tRNA pseudouridine synthase B (EC 5.4.99.-) (tRNA| pseudouridine 55 synthase) (Psi55 synthase) (tRNA-uridine isomerase) (tRNA pseudouridylate synthase) Length = 303 Score = 28.5 bits (62), Expect = 5.2 Identities = 12/38 (31%), Positives = 22/38 (57%) Frame = +1 Query: 52 TQSARNNKQINLNNIQDLTLDQTEARIPKLNTSIRHLT 165 T NN+ L+ +QD+ L Q A + ++ +++HLT Sbjct: 205 TAGFENNRMYTLDELQDMPLSQRLACLIPIDQAVQHLT 242
>TRUB_LEGPH (Q5ZRV6) tRNA pseudouridine synthase B (EC 5.4.99.-) (tRNA| pseudouridine 55 synthase) (Psi55 synthase) (tRNA-uridine isomerase) (tRNA pseudouridylate synthase) Length = 303 Score = 28.5 bits (62), Expect = 5.2 Identities = 12/38 (31%), Positives = 22/38 (57%) Frame = +1 Query: 52 TQSARNNKQINLNNIQDLTLDQTEARIPKLNTSIRHLT 165 T NN+ L+ +QD+ L Q A + ++ +++HLT Sbjct: 205 TAGFENNRMYTLDELQDMPLSQRLACLIPIDQAVQHLT 242
>CRK_XENLA (P87378) SH2/SH3 adaptor crk (Adapter molecule crk) (CRK2)| Length = 296 Score = 27.7 bits (60), Expect = 8.8 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +3 Query: 78 NKLKQHPGPDSGPN*SPYTQTEHKHPSPN 164 N+ HP P GP PY Q P PN Sbjct: 197 NQENSHPQPLGGPEPGPYAQPSVNTPLPN 225 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 26,414,204 Number of Sequences: 219361 Number of extensions: 443655 Number of successful extensions: 1317 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1296 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1316 length of database: 80,573,946 effective HSP length: 35 effective length of database: 72,896,311 effective search space used: 1749511464 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)