ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbart25d01 |
|---|---|
| Clone Library Name | barley_pub |
>IAA30_ORYSA (P0C132) Auxin-responsive protein IAA30 (Indoleacetic acid-induced| protein 30) Length = 277 Score = 80.1 bits (196), Expect = 3e-15 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -3 Query: 490 DVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS 380 DVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS Sbjct: 241 DVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS 277
>IAA16_ARATH (O24407) Auxin-responsive protein IAA16 (Indoleacetic acid-induced| protein 16) Length = 236 Score = 77.0 bits (188), Expect = 3e-14 Identities = 34/37 (91%), Positives = 37/37 (100%) Frame = -3 Query: 490 DVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS 380 DVPWEMFV+SCKR+RIMKGSEAIGLAPRA+EKCKNRS Sbjct: 200 DVPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKNRS 236
>IAA7_ARATH (Q38825) Auxin-responsive protein IAA7 (Indoleacetic acid-induced| protein 7) (Auxin resistant 2) Length = 243 Score = 75.1 bits (183), Expect = 1e-13 Identities = 36/38 (94%), Positives = 37/38 (97%), Gaps = 1/38 (2%) Frame = -3 Query: 490 DVPWEMFVESCKRLRIMKGSEAIGLAPRAMEK-CKNRS 380 DVPWEMFVESCKRLRIMKGSEA+GLAPRAMEK CKNRS Sbjct: 206 DVPWEMFVESCKRLRIMKGSEAVGLAPRAMEKYCKNRS 243
>IAA14_ARATH (Q38832) Auxin-responsive protein IAA14 (Indoleacetic acid-induced| protein 14) (SOLITARY-ROOT protein) Length = 228 Score = 73.6 bits (179), Expect = 3e-13 Identities = 35/37 (94%), Positives = 35/37 (94%) Frame = -3 Query: 490 DVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS 380 DVPW MFVESCKRLRIMKGSEAIGLAPRAMEK KNRS Sbjct: 192 DVPWPMFVESCKRLRIMKGSEAIGLAPRAMEKFKNRS 228
>IAA11_ORYSA (Q75GK0) Auxin-responsive protein IAA11 (Indoleacetic acid-induced| protein 11) Length = 233 Score = 73.2 bits (178), Expect = 4e-13 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = -3 Query: 490 DVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKN 386 DVPWEMFVESCKRLRIMKGSEAIGLAPRA+EKCK+ Sbjct: 199 DVPWEMFVESCKRLRIMKGSEAIGLAPRAVEKCKS 233
>AUX28_SOYBN (P13089) Auxin-induced protein AUX28| Length = 243 Score = 71.2 bits (173), Expect = 1e-12 Identities = 35/39 (89%), Positives = 35/39 (89%), Gaps = 2/39 (5%) Frame = -3 Query: 490 DVPWEMFVESCKRLRIMKGSEAI--GLAPRAMEKCKNRS 380 DVPWEMFVESCKRLRIMKG EAI GLAPRAM KCKNRS Sbjct: 205 DVPWEMFVESCKRLRIMKGKEAIGLGLAPRAMAKCKNRS 243
>IAA17_ARATH (P93830) Auxin-responsive protein IAA17 (Indoleacetic acid-induced| protein 17) (Auxin response 3) Length = 229 Score = 70.5 bits (171), Expect = 2e-12 Identities = 30/37 (81%), Positives = 36/37 (97%) Frame = -3 Query: 490 DVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS 380 DVPW MFV++CKRLR+MKGS+AIGLAPRAMEKCK+R+ Sbjct: 193 DVPWPMFVDTCKRLRLMKGSDAIGLAPRAMEKCKSRA 229
>IAA13_ORYSA (Q7Y1Y5) Auxin-responsive protein IAA13 (Indoleacetic acid-induced| protein 13) Length = 236 Score = 70.1 bits (170), Expect = 3e-12 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = -3 Query: 490 DVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS 380 DVPW+MFVESCKRLRIMKGSEAIGLAPRA +K KN+S Sbjct: 200 DVPWQMFVESCKRLRIMKGSEAIGLAPRAKDKYKNKS 236
>IAA3_ORYSA (Q5NB25) Auxin-responsive protein IAA3 (Indoleacetic acid-induced| protein 3) Length = 263 Score = 67.0 bits (162), Expect = 3e-11 Identities = 30/37 (81%), Positives = 34/37 (91%) Frame = -3 Query: 490 DVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS 380 DVPWEMF +SC+RLRIMKGS+AIGLAPRA EK KNR+ Sbjct: 227 DVPWEMFTDSCRRLRIMKGSDAIGLAPRAGEKSKNRN 263
>IAA27_ARATH (Q9ZSY8) Auxin-responsive protein IAA27 (Indoleacetic acid-induced| protein 27) (Auxin-induced protein 27) (Phytochrome-associated protein 2) Length = 305 Score = 67.0 bits (162), Expect = 3e-11 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = -3 Query: 490 DVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS 380 DVPWEMF+ SCK+LRIMK SEAIGLAPR MEKC++R+ Sbjct: 269 DVPWEMFICSCKKLRIMKSSEAIGLAPRVMEKCRSRN 305
>IAA17_ORYSA (Q75GB1) Auxin-responsive protein IAA17 (Indoleacetic acid-induced| protein 17) Length = 257 Score = 66.6 bits (161), Expect = 3e-11 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = -3 Query: 490 DVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS 380 DVPWEMF SC+RLRIMKGS+AIGLAPRA++K KNR+ Sbjct: 221 DVPWEMFANSCRRLRIMKGSDAIGLAPRAVDKSKNRN 257
>IAA21_ORYSA (Q5Z749) Auxin-responsive protein IAA21 (Indoleacetic acid-induced| protein 21) Length = 266 Score = 64.3 bits (155), Expect = 2e-10 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = -3 Query: 490 DVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS 380 DVPW MF +SC+RLRIMKGS+A+GLAPRA +K KNR+ Sbjct: 230 DVPWRMFTDSCRRLRIMKGSDAVGLAPRATDKSKNRN 266
>IAA8_ARATH (Q38826) Auxin-responsive protein IAA8 (Indoleacetic acid-induced| protein 8) Length = 321 Score = 58.9 bits (141), Expect = 7e-09 Identities = 24/36 (66%), Positives = 33/36 (91%) Frame = -3 Query: 490 DVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNR 383 DVPWE+F E+C++L+IMKGS++IGLAP A+EK KN+ Sbjct: 283 DVPWEIFTETCQKLKIMKGSDSIGLAPGAVEKSKNK 318
>IAA9_ARATH (Q38827) Auxin-responsive protein IAA9 (Indoleacetic acid-induced| protein 9) Length = 338 Score = 57.8 bits (138), Expect = 2e-08 Identities = 27/39 (69%), Positives = 33/39 (84%), Gaps = 2/39 (5%) Frame = -3 Query: 490 DVPWEMFVESCKRLRIMKGSEAIGL--APRAMEKCKNRS 380 DVPWEMF++ CK+L+IMKG +AIGL APRAMEK K R+ Sbjct: 300 DVPWEMFIDVCKKLKIMKGCDAIGLAAAPRAMEKSKMRA 338
>IAA1_ORYSA (Q5VRD1) Auxin-responsive protein IAA1 (Indoleacetic acid-induced| protein 1) Length = 199 Score = 53.5 bits (127), Expect = 3e-07 Identities = 22/31 (70%), Positives = 28/31 (90%) Frame = -3 Query: 490 DVPWEMFVESCKRLRIMKGSEAIGLAPRAME 398 DVPW+MFVE+C+RLR+MK SEA+ LAPRA + Sbjct: 169 DVPWKMFVETCQRLRLMKSSEAVNLAPRAAQ 199
>IAA23_ORYSA (Q69VE0) Auxin-responsive protein IAA23 (Indoleacetic acid-induced| protein 23) Length = 193 Score = 52.4 bits (124), Expect = 7e-07 Identities = 21/28 (75%), Positives = 26/28 (92%) Frame = -3 Query: 490 DVPWEMFVESCKRLRIMKGSEAIGLAPR 407 DVPW+MFVESCKR+R+MK SEA+ L+PR Sbjct: 162 DVPWKMFVESCKRIRLMKSSEAVNLSPR 189
>IAA15_ORYSA (Q6AT10) Auxin-responsive protein IAA15 (Indoleacetic acid-induced| protein 15) Length = 212 Score = 52.0 bits (123), Expect = 9e-07 Identities = 21/29 (72%), Positives = 27/29 (93%) Frame = -3 Query: 490 DVPWEMFVESCKRLRIMKGSEAIGLAPRA 404 DVPW+MFVE+C+RLR+MK SEA+ LAPR+ Sbjct: 183 DVPWKMFVETCQRLRLMKSSEAVNLAPRS 211
>IAA19_ORYSA (Q6AT33) Auxin-responsive protein IAA19 (Indoleacetic acid-induced| protein 19) Length = 281 Score = 50.4 bits (119), Expect = 3e-06 Identities = 18/32 (56%), Positives = 29/32 (90%) Frame = -3 Query: 490 DVPWEMFVESCKRLRIMKGSEAIGLAPRAMEK 395 D+PW++F SC++LRIM+GS+A G+APR++E+ Sbjct: 245 DLPWDLFTTSCRKLRIMRGSDAAGMAPRSLEQ 276
>IAA4_ARATH (P33077) Auxin-responsive protein IAA4 (Indoleacetic acid-induced| protein 4) (Auxin-induced protein AUX2-11) Length = 186 Score = 49.3 bits (116), Expect = 6e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = -3 Query: 490 DVPWEMFVESCKRLRIMKGSEAIGL 416 DVPWEMFV SCKRLRIMKGSE GL Sbjct: 157 DVPWEMFVSSCKRLRIMKGSEVKGL 181
>AX22B_PHAAU (P32294) Auxin-induced protein 22B (Indole-3-acetic acid-induced| protein ARG4) Length = 196 Score = 49.3 bits (116), Expect = 6e-06 Identities = 22/25 (88%), Positives = 23/25 (92%) Frame = -3 Query: 490 DVPWEMFVESCKRLRIMKGSEAIGL 416 DVPW+MFV SCKRLRIMKGSEA GL Sbjct: 168 DVPWDMFVTSCKRLRIMKGSEARGL 192
>AX22D_PHAAU (O24542) Auxin-induced protein 22D (Indole-3-acetic acid-induced| protein ARG13) Length = 193 Score = 48.9 bits (115), Expect = 7e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = -3 Query: 490 DVPWEMFVESCKRLRIMKGSEAIGL 416 DVPW MFV SCKRLRIMKGSEA GL Sbjct: 166 DVPWNMFVSSCKRLRIMKGSEAKGL 190
>IAA4_PEA (P49679) Auxin-induced protein IAA4| Length = 189 Score = 48.1 bits (113), Expect = 1e-05 Identities = 21/25 (84%), Positives = 23/25 (92%) Frame = -3 Query: 490 DVPWEMFVESCKRLRIMKGSEAIGL 416 DVPW+MFV SCKRLRIMKG+EA GL Sbjct: 161 DVPWDMFVTSCKRLRIMKGTEAKGL 185
>IAA3_ARATH (Q38822) Auxin-responsive protein IAA3 (Indoleacetic acid-induced| protein 3) (Short hypocotyl) (Suppressor of HY2) Length = 189 Score = 47.8 bits (112), Expect = 2e-05 Identities = 21/25 (84%), Positives = 23/25 (92%) Frame = -3 Query: 490 DVPWEMFVESCKRLRIMKGSEAIGL 416 DVPWEMF+ +CKRLRIMKGSEA GL Sbjct: 161 DVPWEMFICTCKRLRIMKGSEAKGL 185
>AX22E_PHAAU (O24543) Auxin-induced protein 22E (Indole-3-acetic acid-induced| protein ARG14) Length = 203 Score = 47.4 bits (111), Expect = 2e-05 Identities = 21/25 (84%), Positives = 22/25 (88%) Frame = -3 Query: 490 DVPWEMFVESCKRLRIMKGSEAIGL 416 DVPW MFV SCKRLRI+KGSEA GL Sbjct: 176 DVPWNMFVSSCKRLRIIKGSEAKGL 200
>IAA12_ARATH (Q38830) Auxin-responsive protein IAA12 (Indoleacetic acid-induced| protein 12) (BODENLOS protein) Length = 239 Score = 47.4 bits (111), Expect = 2e-05 Identities = 22/32 (68%), Positives = 24/32 (75%) Frame = -3 Query: 490 DVPWEMFVESCKRLRIMKGSEAIGLAPRAMEK 395 DVPW MF+ S KRLRIM SEA GLAPR E+ Sbjct: 199 DVPWRMFINSVKRLRIMGTSEASGLAPRRQEQ 230
>AUX22_SOYBN (P13088) Auxin-induced protein AUX22| Length = 195 Score = 47.0 bits (110), Expect = 3e-05 Identities = 23/34 (67%), Positives = 26/34 (76%), Gaps = 2/34 (5%) Frame = -3 Query: 490 DVPWEMFVESCKRLRIMKGSEA--IGLAPRAMEK 395 DVPWEMF+ESCKRLRIMK S+A GL P+ K Sbjct: 154 DVPWEMFMESCKRLRIMKKSDAKGFGLQPKGSLK 187
>IAA24_ORYSA (Q6ZL57) Auxin-responsive protein IAA24 (Indoleacetic acid-induced| protein 24) Length = 219 Score = 46.6 bits (109), Expect = 4e-05 Identities = 19/22 (86%), Positives = 21/22 (95%) Frame = -3 Query: 490 DVPWEMFVESCKRLRIMKGSEA 425 DVPWEMF+ SCK+LRIMKGSEA Sbjct: 197 DVPWEMFISSCKKLRIMKGSEA 218
>IAA5_ORYSA (Q59AF3) Auxin-responsive protein IAA5 (Indoleacetic acid-induced| protein 5) Length = 271 Score = 46.6 bits (109), Expect = 4e-05 Identities = 16/32 (50%), Positives = 28/32 (87%) Frame = -3 Query: 490 DVPWEMFVESCKRLRIMKGSEAIGLAPRAMEK 395 D+PW++F C++L+IM+GS+A G+APR++E+ Sbjct: 235 DLPWDLFTTICRKLKIMRGSDAAGIAPRSIEQ 266
>IAA6_PEA (P49680) Auxin-induced protein IAA6| Length = 179 Score = 46.6 bits (109), Expect = 4e-05 Identities = 20/24 (83%), Positives = 22/24 (91%) Frame = -3 Query: 490 DVPWEMFVESCKRLRIMKGSEAIG 419 DVPWEMF+ESCKRLRIMK S+A G Sbjct: 143 DVPWEMFIESCKRLRIMKRSDAKG 166
>IAA19_ARATH (O24409) Auxin-responsive protein IAA19 (Indoleacetic acid-induced| protein 19) (MASSUGU2 protein) Length = 197 Score = 46.6 bits (109), Expect = 4e-05 Identities = 22/34 (64%), Positives = 27/34 (79%), Gaps = 2/34 (5%) Frame = -3 Query: 490 DVPWEMFVESCKRLRIMKGSEA--IGLAPRAMEK 395 DVPW MF+ESCKRLRIMK S+A GL PR +++ Sbjct: 164 DVPWGMFLESCKRLRIMKRSDATGFGLQPRGVDE 197
>IAA26_ORYSA (Q652A1) Auxin-responsive protein IAA26 (Indoleacetic acid-induced| protein 26) Length = 140 Score = 45.8 bits (107), Expect = 6e-05 Identities = 19/29 (65%), Positives = 23/29 (79%) Frame = -3 Query: 490 DVPWEMFVESCKRLRIMKGSEAIGLAPRA 404 DVPWEMFV SCKR+R+M+ EA GL+ A Sbjct: 112 DVPWEMFVSSCKRMRVMRACEARGLSSNA 140
>AX22A_PHAAU (P32293) Auxin-induced protein 22A (Indole-3-acetic acid-induced| protein ARG3) Length = 194 Score = 45.8 bits (107), Expect = 6e-05 Identities = 22/34 (64%), Positives = 26/34 (76%), Gaps = 2/34 (5%) Frame = -3 Query: 490 DVPWEMFVESCKRLRIMKGSEA--IGLAPRAMEK 395 DVPWEMF+ESCKRLRIMK ++A GL P+ K Sbjct: 153 DVPWEMFMESCKRLRIMKRADAKGFGLQPKGSLK 186
>IAA31_ORYSA (P0C133) Auxin-responsive protein IAA31 (Indoleacetic acid-induced| protein 31) Length = 197 Score = 45.4 bits (106), Expect = 8e-05 Identities = 20/25 (80%), Positives = 23/25 (92%) Frame = -3 Query: 490 DVPWEMFVESCKRLRIMKGSEAIGL 416 DVP+EMF+ +CKRLRIMKGSEA GL Sbjct: 168 DVPFEMFISTCKRLRIMKGSEARGL 192
>IAA13_ARATH (Q38831) Auxin-responsive protein IAA13 (Indoleacetic acid-induced| protein 13) Length = 247 Score = 45.4 bits (106), Expect = 8e-05 Identities = 21/31 (67%), Positives = 23/31 (74%) Frame = -3 Query: 490 DVPWEMFVESCKRLRIMKGSEAIGLAPRAME 398 DVPW MF+ S KRLR+MK SEA GLA R E Sbjct: 207 DVPWRMFINSVKRLRVMKTSEANGLAARNQE 237
>IAA15_ARATH (Q9C966) Auxin-responsive protein IAA15 (Indoleacetic acid-induced| protein 15) Length = 179 Score = 45.4 bits (106), Expect = 8e-05 Identities = 19/25 (76%), Positives = 22/25 (88%) Frame = -3 Query: 490 DVPWEMFVESCKRLRIMKGSEAIGL 416 DVPW MFVESCKR+R+MK +AIGL Sbjct: 155 DVPWMMFVESCKRMRLMKTGDAIGL 179
>IAA14_ORYSA (Q7Y1H8) Auxin-responsive protein IAA14 (Indoleacetic acid-induced| protein 14) Length = 195 Score = 44.3 bits (103), Expect = 2e-04 Identities = 17/22 (77%), Positives = 21/22 (95%) Frame = -3 Query: 490 DVPWEMFVESCKRLRIMKGSEA 425 DVPW+MF+ SCK+LRIM+GSEA Sbjct: 173 DVPWDMFISSCKKLRIMRGSEA 194
>AX22C_PHAAU (O24541) Auxin-induced protein 22C (Indole-3-acetic acid-induced| protein ARG12) Length = 188 Score = 44.3 bits (103), Expect = 2e-04 Identities = 20/24 (83%), Positives = 21/24 (87%) Frame = -3 Query: 490 DVPWEMFVESCKRLRIMKGSEAIG 419 DVPWEMF ESCKRLRIMK S+A G Sbjct: 147 DVPWEMFRESCKRLRIMKRSDAKG 170
>IAA2_ARATH (P49678) Auxin-responsive protein IAA2 (Indoleacetic acid-induced| protein 2) Length = 174 Score = 43.9 bits (102), Expect = 2e-04 Identities = 19/25 (76%), Positives = 21/25 (84%) Frame = -3 Query: 490 DVPWEMFVESCKRLRIMKGSEAIGL 416 DVPW+MF SCKRLRIMKGS+A L Sbjct: 146 DVPWDMFSSSCKRLRIMKGSDAPAL 170
>IAA10_ORYSA (Q59AA1) Auxin-responsive protein IAA10 (Indoleacetic acid-induced| protein 10) Length = 281 Score = 43.1 bits (100), Expect = 4e-04 Identities = 20/28 (71%), Positives = 22/28 (78%) Frame = -3 Query: 490 DVPWEMFVESCKRLRIMKGSEAIGLAPR 407 DVPWEMFV S KRLRIM+ S+A GL R Sbjct: 239 DVPWEMFVSSVKRLRIMRTSDANGLGQR 266
>IAA6_ARATH (Q38824) Auxin-responsive protein IAA6 (Indoleacetic acid-induced| protein 6) Length = 189 Score = 42.7 bits (99), Expect = 5e-04 Identities = 18/24 (75%), Positives = 21/24 (87%) Frame = -3 Query: 490 DVPWEMFVESCKRLRIMKGSEAIG 419 DVPW+MF ESCKRLRI+K S+A G Sbjct: 160 DVPWQMFKESCKRLRIVKRSDATG 183
>IAA1_ARATH (P49677) Auxin-responsive protein IAA1 (Indoleacetic acid-induced| protein 1) Length = 168 Score = 42.0 bits (97), Expect = 9e-04 Identities = 17/22 (77%), Positives = 20/22 (90%) Frame = -3 Query: 490 DVPWEMFVESCKRLRIMKGSEA 425 DVPW+MF SC++LRIMKGSEA Sbjct: 143 DVPWDMFSSSCQKLRIMKGSEA 164
>IAA12_ORYSA (Q75GK1) Auxin-responsive protein IAA12 (Indoleacetic acid-induced| protein 12) Length = 226 Score = 42.0 bits (97), Expect = 9e-04 Identities = 20/32 (62%), Positives = 26/32 (81%), Gaps = 1/32 (3%) Frame = -3 Query: 490 DVPWEMFVESCKRLRIMKGSEAIGL-APRAME 398 DVP++MF +CK+LRIMK SEA GL +PR M+ Sbjct: 194 DVPFDMFTSTCKKLRIMKRSEATGLGSPRQMK 225
>IAA28_ARATH (Q9XFM0) Auxin-responsive protein IAA28 (Indoleacetic acid-induced| protein 28) Length = 175 Score = 41.2 bits (95), Expect = 0.002 Identities = 17/28 (60%), Positives = 21/28 (75%) Frame = -3 Query: 490 DVPWEMFVESCKRLRIMKGSEAIGLAPR 407 DVPWEMFV + KRL ++K S A L+PR Sbjct: 143 DVPWEMFVSTVKRLHVLKTSHAFSLSPR 170
>IAA5_ARATH (P33078) Auxin-responsive protein IAA5 (Indoleacetic acid-induced| protein 5) (Auxin-induced protein AUX2-27) Length = 163 Score = 39.7 bits (91), Expect = 0.004 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -3 Query: 490 DVPWEMFVESCKRLRIMKGS 431 DVPWEMF+ SCKRLRIMK S Sbjct: 140 DVPWEMFLGSCKRLRIMKRS 159
>IAA11_ARATH (Q38829) Auxin-responsive protein IAA11 (Indoleacetic acid-induced| protein 11) Length = 246 Score = 38.9 bits (89), Expect = 0.008 Identities = 18/26 (69%), Positives = 20/26 (76%) Frame = -3 Query: 490 DVPWEMFVESCKRLRIMKGSEAIGLA 413 DVPW MF+ S +RLRIMK SEA G A Sbjct: 217 DVPWGMFIGSVRRLRIMKTSEATGKA 242
>IAA26_ARATH (Q8LAL2) Auxin-responsive protein IAA26 (Indoleacetic acid-induced| protein 26) (Phytochrome-associated protein 1) Length = 269 Score = 37.4 bits (85), Expect = 0.022 Identities = 15/21 (71%), Positives = 18/21 (85%) Frame = -3 Query: 490 DVPWEMFVESCKRLRIMKGSE 428 DVPW+MFV S KRLR++K SE Sbjct: 232 DVPWQMFVSSVKRLRVIKSSE 252
>IAA18_ARATH (O24408) Auxin-responsive protein IAA18 (Indoleacetic acid-induced| protein 18) Length = 267 Score = 36.6 bits (83), Expect = 0.038 Identities = 15/21 (71%), Positives = 18/21 (85%) Frame = -3 Query: 490 DVPWEMFVESCKRLRIMKGSE 428 DVPW+MFV S KRLR++K SE Sbjct: 230 DVPWQMFVSSVKRLRVIKTSE 250
>IAA2_ORYSA (Q9LG86) Auxin-responsive protein IAA2 (Indoleacetic acid-induced| protein 2) Length = 238 Score = 35.0 bits (79), Expect = 0.11 Identities = 12/21 (57%), Positives = 18/21 (85%) Frame = -3 Query: 490 DVPWEMFVESCKRLRIMKGSE 428 DVPW+MF+ + KRLR++K S+ Sbjct: 198 DVPWQMFIATAKRLRVLKSSD 218
>IAA7_ORYSA (Q6H543) Auxin-responsive protein IAA7 (Indoleacetic acid-induced| protein 7) Length = 300 Score = 34.3 bits (77), Expect = 0.19 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = -3 Query: 490 DVPWEMFVESCKRLRIMKGSE 428 DVPW MFV S KRLR++K S+ Sbjct: 263 DVPWGMFVSSVKRLRVLKTSD 283
>IAA6_ORYSA (Q8LQ74) Auxin-responsive protein IAA6 (Indoleacetic acid-induced| protein 6) Length = 335 Score = 33.9 bits (76), Expect = 0.24 Identities = 12/21 (57%), Positives = 18/21 (85%) Frame = -3 Query: 490 DVPWEMFVESCKRLRIMKGSE 428 DVPW++FV + KRLR+++ SE Sbjct: 303 DVPWKVFVSTAKRLRVLRSSE 323
>IAA18_ORYSA (Q5W670) Auxin-responsive protein IAA18 (Indoleacetic acid-induced| protein 18) Length = 327 Score = 33.5 bits (75), Expect = 0.32 Identities = 12/21 (57%), Positives = 18/21 (85%) Frame = -3 Query: 490 DVPWEMFVESCKRLRIMKGSE 428 D+PW++FV + KRLR+M+ SE Sbjct: 295 DIPWKVFVSTVKRLRVMRRSE 315
>IAA10_ARATH (Q38828) Auxin-responsive protein IAA10 (Indoleacetic acid-induced| protein 10) Length = 261 Score = 33.5 bits (75), Expect = 0.32 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = -3 Query: 490 DVPWEMFVESCKRLRIMKGSEAIGL 416 DVPW+MF+ S RLRIMK S G+ Sbjct: 235 DVPWQMFLGSVTRLRIMKTSIGAGV 259
>IAA34_ARATH (Q9C5X0) Auxin-responsive protein IAA34 (Indoleacetic acid-induced| protein 34) Length = 185 Score = 32.0 bits (71), Expect = 0.93 Identities = 12/23 (52%), Positives = 18/23 (78%) Frame = -3 Query: 490 DVPWEMFVESCKRLRIMKGSEAI 422 DVPW F+ES +RLRI + ++A+ Sbjct: 160 DVPWNEFIESVERLRITRRNDAV 182
>IAA16_ORYSA (P0C127) Auxin-responsive protein IAA16 (Indoleacetic acid-induced| protein 16) Length = 228 Score = 32.0 bits (71), Expect = 0.93 Identities = 10/21 (47%), Positives = 17/21 (80%) Frame = -3 Query: 490 DVPWEMFVESCKRLRIMKGSE 428 DVPW MF+ + +RLR+++ S+ Sbjct: 191 DVPWNMFIAAARRLRVLRSSD 211
>IAA8_ORYSA (Q6Z5M0) Auxin-responsive protein IAA8 (Indoleacetic acid-induced| protein 8) Length = 205 Score = 31.6 bits (70), Expect = 1.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = -3 Query: 490 DVPWEMFVESCKRLRIMKGSE 428 DVPWE+F+ S KRLRI + + Sbjct: 179 DVPWELFLTSVKRLRIARADD 199
>IAA32_ARATH (Q8RYC6) Auxin-responsive protein IAA32 (Indoleacetic acid-induced| protein 32) Length = 191 Score = 30.8 bits (68), Expect = 2.1 Identities = 12/23 (52%), Positives = 18/23 (78%) Frame = -3 Query: 490 DVPWEMFVESCKRLRIMKGSEAI 422 DVPW+ FVES R+RI + ++A+ Sbjct: 166 DVPWKEFVESVDRMRIARRNDAL 188
>IAA4_ORYSA (Q59AF4) Auxin-responsive protein IAA4 (Indoleacetic acid-induced| protein 4) Length = 203 Score = 30.0 bits (66), Expect = 3.5 Identities = 11/18 (61%), Positives = 15/18 (83%) Frame = -3 Query: 490 DVPWEMFVESCKRLRIMK 437 DVPWE+F+ S K+LRI + Sbjct: 182 DVPWELFLSSVKKLRIAR 199
>IAA30_ARATH (Q9M1R4) Putative auxin-responsive protein IAA30 (Putative| indoleacetic acid-induced protein 30) Length = 172 Score = 30.0 bits (66), Expect = 3.5 Identities = 11/18 (61%), Positives = 15/18 (83%) Frame = -3 Query: 490 DVPWEMFVESCKRLRIMK 437 DVPWEMF+ S +RL+I + Sbjct: 151 DVPWEMFLSSVRRLKISR 168
>IAA27_ORYSA (P0C129) Auxin-responsive protein IAA27 (Indoleacetic acid-induced| protein 27) Length = 143 Score = 30.0 bits (66), Expect = 3.5 Identities = 16/31 (51%), Positives = 18/31 (58%) Frame = -3 Query: 490 DVPWEMFVESCKRLRIMKGSEAIGLAPRAME 398 DVPWE+F+ S KRL I K APR E Sbjct: 102 DVPWELFLASAKRLYIAKNP-----APRNKE 127
>VATI_CHLTR (O84307) V-type ATP synthase subunit I (EC 3.6.3.14) (V-type ATPase| subunit I) Length = 649 Score = 29.3 bits (64), Expect = 6.0 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = -1 Query: 219 KSHLVIYIRKKKPRTCEMYLY 157 + HL +RKKK R CE+Y Y Sbjct: 188 EGHLQALLRKKKARVCELYAY 208
>VATI_CHLMU (Q9PK88) V-type ATP synthase subunit I (EC 3.6.3.14) (V-type ATPase| subunit I) Length = 649 Score = 29.3 bits (64), Expect = 6.0 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = -1 Query: 219 KSHLVIYIRKKKPRTCEMYLY 157 + HL +RKKK R CE+Y Y Sbjct: 188 EEHLQTLLRKKKARVCELYAY 208
>IAA20_ARATH (O24410) Auxin-responsive protein IAA20 (Indoleacetic acid-induced| protein 20) Length = 175 Score = 29.3 bits (64), Expect = 6.0 Identities = 10/20 (50%), Positives = 16/20 (80%) Frame = -3 Query: 490 DVPWEMFVESCKRLRIMKGS 431 DVPWEMF+ + +RL+I + + Sbjct: 153 DVPWEMFLSTVRRLKISRAN 172
>IAA31_ARATH (Q8H174) Auxin-responsive protein IAA31 (Indoleacetic acid-induced| protein 31) Length = 158 Score = 29.3 bits (64), Expect = 6.0 Identities = 9/18 (50%), Positives = 16/18 (88%) Frame = -3 Query: 490 DVPWEMFVESCKRLRIMK 437 D+PW+MF+E+ +RL+I + Sbjct: 137 DIPWDMFLETVRRLKITR 154
>IAA20_ORYSA (Q5VRR0) Auxin-responsive protein IAA20 (Indoleacetic acid-induced| protein 20) Length = 183 Score = 29.3 bits (64), Expect = 6.0 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = -3 Query: 490 DVPWEMFVESCKRLRIM 440 DVPWE F +S KRL+I+ Sbjct: 166 DVPWEAFAKSVKRLKIL 182
>COFD_HALSA (Q9HPX4) LPPG:FO 2-phopspho-L-lactate transferase (EC 2.7.1.-)| Length = 336 Score = 28.9 bits (63), Expect = 7.8 Identities = 9/32 (28%), Positives = 18/32 (56%) Frame = -2 Query: 464 VMQAPSDNERIRSYWPCTKGDGEMQEQELRGG 369 ++Q P + +++W GD +++ E RGG Sbjct: 170 IVQTPDGEQHFQTFWVAEHGDPTVEDVEFRGG 201 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 61,133,175 Number of Sequences: 219361 Number of extensions: 1000985 Number of successful extensions: 1896 Number of sequences better than 10.0: 65 Number of HSP's better than 10.0 without gapping: 1879 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1894 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3478785780 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
