Clone Name | rbart25c08 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | Y303_HELPY (O25074) Probable GTP-binding protein HP0303 | 33 | 0.45 | 2 | Y303_HELPJ (Q9ZMD3) Probable GTP-binding protein jhp_0288 | 33 | 0.45 | 3 | ZFP2_ARATH (Q39261) Zinc finger protein 2 | 30 | 3.8 | 4 | EXPA_DROME (Q07436) Protein expanded | 28 | 8.6 | 5 | RL13_STAEQ (Q5HM31) 50S ribosomal protein L13 | 28 | 8.6 |
---|
>Y303_HELPY (O25074) Probable GTP-binding protein HP0303| Length = 360 Score = 32.7 bits (73), Expect = 0.45 Identities = 21/63 (33%), Positives = 32/63 (50%), Gaps = 1/63 (1%) Frame = -1 Query: 378 ARNGCVGSLGVDVYAAREKRRVTYHSRGTGG-HKCAKLEFTAIADKTRVVFQSSNHHTVN 202 A G G LG + + K++ TY +G G KC +LE IAD V F ++ T+ Sbjct: 114 ALKGGKGGLGNAHFKSATKQQPTYAQKGLEGVEKCVRLELKLIADIGLVGFPNAGKSTLI 173 Query: 201 ATL 193 +T+ Sbjct: 174 STI 176
>Y303_HELPJ (Q9ZMD3) Probable GTP-binding protein jhp_0288| Length = 360 Score = 32.7 bits (73), Expect = 0.45 Identities = 21/63 (33%), Positives = 32/63 (50%), Gaps = 1/63 (1%) Frame = -1 Query: 378 ARNGCVGSLGVDVYAAREKRRVTYHSRGTGG-HKCAKLEFTAIADKTRVVFQSSNHHTVN 202 A G G LG + + K++ TY +G G KC +LE IAD V F ++ T+ Sbjct: 114 ALKGGKGGLGNAHFKSATKQQPTYAQKGLEGVEKCVRLELKLIADIGLVGFPNAGKSTLI 173 Query: 201 ATL 193 +T+ Sbjct: 174 STI 176
>ZFP2_ARATH (Q39261) Zinc finger protein 2| Length = 150 Score = 29.6 bits (65), Expect = 3.8 Identities = 19/43 (44%), Positives = 28/43 (65%), Gaps = 1/43 (2%) Frame = -1 Query: 342 VYAAREKRRVTYHSRGTGGHKCA-KLEFTAIADKTRVVFQSSN 217 V++ +R Y S+ GGH+ A KLE T +A K+R +F+SSN Sbjct: 51 VFSCNYCQRKFYSSQALGGHQNAHKLERT-LAKKSRELFRSSN 92
>EXPA_DROME (Q07436) Protein expanded| Length = 1427 Score = 28.5 bits (62), Expect = 8.6 Identities = 19/56 (33%), Positives = 28/56 (50%), Gaps = 5/56 (8%) Frame = +2 Query: 266 SSLAHLCPPVPREWYVTLRFSRAAYTSTPSDP----THPLRAS-PTLNESL*DRPG 418 +++A PP P Y+ ++ S A Y STP P TH AS L+++ PG Sbjct: 1074 AAMAQAAPPPPHHPYLAMQVSPAIYRSTPYLPLTLSTHSRYASTQNLSDTYVQLPG 1129
>RL13_STAEQ (Q5HM31) 50S ribosomal protein L13| Length = 145 Score = 28.5 bits (62), Expect = 8.6 Identities = 20/62 (32%), Positives = 32/62 (51%), Gaps = 6/62 (9%) Frame = -1 Query: 381 DARNGCVGSLGVDVYAA-REKRRVTYHSR-GTGGH----KCAKLEFTAIADKTRVVFQSS 220 DA +G L +V A R K +VTY TG + +K+EFT ++ ++ ++ S Sbjct: 20 DAEGQTLGRLSSEVAAILRGKNKVTYTPHVDTGDYVIIINASKIEFTGNKEQDKMYYRHS 79 Query: 219 NH 214 NH Sbjct: 80 NH 81 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 53,802,752 Number of Sequences: 219361 Number of extensions: 964850 Number of successful extensions: 3380 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3206 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3376 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2909956200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)