| Clone Name | rbart25a12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RETO_ESCCA (P30986) Reticuline oxidase precursor (EC 1.21.3.3) (... | 82 | 7e-16 | 2 | RETO_PAPSO (P93479) Reticuline oxidase precursor (EC 1.21.3.3) (... | 76 | 4e-14 | 3 | MCRA_STRLA (P43485) Mitomycin radical oxidase (EC 1.5.3.-) | 32 | 1.1 | 4 | ELOA2_HUMAN (Q8IYF1) RNA polymerase II transcription factor SIII... | 29 | 5.4 | 5 | RNH2_PSE14 (Q48F73) Ribonuclease HII (EC 3.1.26.4) (RNase HII) | 29 | 7.1 |
|---|
>RETO_ESCCA (P30986) Reticuline oxidase precursor (EC 1.21.3.3)| (Berberine-bridge-forming enzyme) (BBE) (Tetrahydroprotoberberine synthase) Length = 538 Score = 82.0 bits (201), Expect = 7e-16 Identities = 41/88 (46%), Positives = 52/88 (59%), Gaps = 5/88 (5%) Frame = -2 Query: 438 WIREFYAFMAPFVSSSPREAYFNYRDLDLG-----ENVVVGNVSSFQAGMVWGQKYFKGN 274 W+ + Y FM PFVS +PR Y N+ DLDLG VV N + + WG+ YF N Sbjct: 436 WLEKVYEFMKPFVSKNPRLGYVNHIDLDLGGIDWGNKTVVNN--AIEISRSWGESYFLSN 493 Query: 273 YQRLAMAKAQIDPDDYFRNEQSIPPFAN 190 Y+RL AK IDP++ F + QSIPP AN Sbjct: 494 YERLIRAKTLIDPNNVFNHPQSIPPMAN 521
>RETO_PAPSO (P93479) Reticuline oxidase precursor (EC 1.21.3.3)| (Berberine-bridge-forming enzyme) (BBE) (Tetrahydroprotoberberine synthase) Length = 535 Score = 76.3 bits (186), Expect = 4e-14 Identities = 37/86 (43%), Positives = 52/86 (60%), Gaps = 4/86 (4%) Frame = -2 Query: 444 TRWIREFYAFMAPFVSSSPREAYFNYRDLDLGENVVVGNVSS----FQAGMVWGQKYFKG 277 + W+ +FY ++ PFVS PR Y N+ DLD+G + N SS + WG++YF Sbjct: 438 SEWLAKFYDYLEPFVSKEPRVGYVNHIDLDIG-GIDWRNKSSTTNAVEIARNWGERYFSS 496 Query: 276 NYQRLAMAKAQIDPDDYFRNEQSIPP 199 NY+RL AK IDP++ F + QSIPP Sbjct: 497 NYERLVKAKTLIDPNNVFNHPQSIPP 522
>MCRA_STRLA (P43485) Mitomycin radical oxidase (EC 1.5.3.-)| Length = 447 Score = 31.6 bits (70), Expect = 1.1 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = -2 Query: 288 YFKGNYQRLAMAKAQIDPDDYFRNEQSIPP 199 Y ++ RL KAQ DPD+ FR +IPP Sbjct: 413 YTPADFARLRAVKAQYDPDNMFRVNFNIPP 442
>ELOA2_HUMAN (Q8IYF1) RNA polymerase II transcription factor SIII subunit A2| (Elongin A2) (EloA2) (Transcription elongation factor B polypeptide 3B) Length = 753 Score = 29.3 bits (64), Expect = 5.4 Identities = 12/29 (41%), Positives = 14/29 (48%) Frame = +1 Query: 385 PRAGAHERRHERVELPDPPGLHGPVPRRH 471 PR+ +H H R PPG P PR H Sbjct: 119 PRSPSHSPEHRRTARRTPPGQQRPHPRSH 147
>RNH2_PSE14 (Q48F73) Ribonuclease HII (EC 3.1.26.4) (RNase HII)| Length = 222 Score = 28.9 bits (63), Expect = 7.1 Identities = 19/46 (41%), Positives = 25/46 (54%), Gaps = 1/46 (2%) Frame = +1 Query: 175 VRSPAIGKWRDALLVPEVVVGVD-LGLGHRQPLVVTLEVLLAPDHP 309 +RSP + D LV ++V GVD +G G VVT V+L P P Sbjct: 1 MRSPIMQTGLDFTLVEDLVAGVDEVGRGPLCGAVVTAAVILDPARP 46 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 55,723,299 Number of Sequences: 219361 Number of extensions: 995009 Number of successful extensions: 2430 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2357 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2428 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3130907202 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)