| Clone Name | rbart25a08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YJZ7_YEAST (P47098) Transposon Ty1 protein B | 32 | 0.70 | 2 | YJZ9_YEAST (P47100) Transposon Ty1 protein B | 30 | 2.0 | 3 | YMU0_YEAST (Q04670) Transposon Ty1 protein B | 30 | 2.0 | 4 | YMT5_YEAST (Q04214) Transposon Ty1 protein B | 30 | 2.0 | 5 | YME4_YEAST (Q04711) Transposon Ty1 protein B | 30 | 2.0 | 6 | YMD9_YEAST (Q03434) Transposon Ty1 protein B | 30 | 2.0 | 7 | BCAS1_MOUSE (Q80YN3) Breast carcinoma amplified sequence 1 homol... | 28 | 7.7 |
|---|
>YJZ7_YEAST (P47098) Transposon Ty1 protein B| Length = 1755 Score = 32.0 bits (71), Expect = 0.70 Identities = 14/35 (40%), Positives = 22/35 (62%) Frame = +2 Query: 233 PIHQYLAFFFLEKQYIMPSNIYTSRIPPLHKGPSS 337 PI QY F+++ K+Y++PSNI I +H S+ Sbjct: 556 PIVQYGDFYWVSKRYLLPSNISVPTINNVHTSEST 590
>YJZ9_YEAST (P47100) Transposon Ty1 protein B| Length = 1755 Score = 30.4 bits (67), Expect = 2.0 Identities = 13/35 (37%), Positives = 22/35 (62%) Frame = +2 Query: 233 PIHQYLAFFFLEKQYIMPSNIYTSRIPPLHKGPSS 337 PI +Y F+++ K+Y++PSNI I +H S+ Sbjct: 556 PIVKYGDFYWVSKKYLLPSNISVPTINNVHTSEST 590
>YMU0_YEAST (Q04670) Transposon Ty1 protein B| Length = 1328 Score = 30.4 bits (67), Expect = 2.0 Identities = 13/35 (37%), Positives = 22/35 (62%) Frame = +2 Query: 233 PIHQYLAFFFLEKQYIMPSNIYTSRIPPLHKGPSS 337 PI +Y F+++ K+Y++PSNI I +H S+ Sbjct: 129 PIVKYGDFYWVSKKYLLPSNISVPTINNVHTSEST 163
>YMT5_YEAST (Q04214) Transposon Ty1 protein B| Length = 1328 Score = 30.4 bits (67), Expect = 2.0 Identities = 13/35 (37%), Positives = 22/35 (62%) Frame = +2 Query: 233 PIHQYLAFFFLEKQYIMPSNIYTSRIPPLHKGPSS 337 PI +Y F+++ K+Y++PSNI I +H S+ Sbjct: 129 PIVKYGDFYWVSKKYLLPSNISVPTINNVHTSEST 163
>YME4_YEAST (Q04711) Transposon Ty1 protein B| Length = 1328 Score = 30.4 bits (67), Expect = 2.0 Identities = 13/35 (37%), Positives = 22/35 (62%) Frame = +2 Query: 233 PIHQYLAFFFLEKQYIMPSNIYTSRIPPLHKGPSS 337 PI +Y F+++ K+Y++PSNI I +H S+ Sbjct: 129 PIVKYGDFYWVSKKYLLPSNISVPTINNVHTSEST 163
>YMD9_YEAST (Q03434) Transposon Ty1 protein B| Length = 1328 Score = 30.4 bits (67), Expect = 2.0 Identities = 13/35 (37%), Positives = 22/35 (62%) Frame = +2 Query: 233 PIHQYLAFFFLEKQYIMPSNIYTSRIPPLHKGPSS 337 PI +Y F+++ K+Y++PSNI I +H S+ Sbjct: 129 PIVKYGDFYWVSKKYLLPSNISVPTINNVHTSEST 163
>BCAS1_MOUSE (Q80YN3) Breast carcinoma amplified sequence 1 homolog (Novel| amplified in breast cancer 1 homolog) Length = 633 Score = 28.5 bits (62), Expect = 7.7 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +1 Query: 352 RADTTPQTQRGRTRSGAGTSPPP 420 +A+ TPQ RG+T++ SPPP Sbjct: 371 KANFTPQETRGKTKATKSCSPPP 393 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 61,331,669 Number of Sequences: 219361 Number of extensions: 1137493 Number of successful extensions: 2378 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 2313 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2378 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2628831825 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)