Clone Name | rbart24h05 |
---|---|
Clone Library Name | barley_pub |
>VGLY_PIARV (P03540) Glycoprotein polyprotein [Contains: Glycoprotein G1;| Glycoprotein G2] Length = 503 Score = 30.8 bits (68), Expect = 2.1 Identities = 16/67 (23%), Positives = 32/67 (47%) Frame = +2 Query: 8 NSWSTKTTHMYSNSIVHTFEEEVAFPSMSTSNVTHGSVVHYTSSSRLEARGIPWNWI*QS 187 N W ++ ++Y+ ++ +EE ++ +++ S+V YT + L GIP + Sbjct: 415 NDWLWESQNLYNEMLMKEYEERQGKTPLALTDICFWSLVFYTITVFLHIVGIPTHRHIIG 474 Query: 188 GGVVSPH 208 G PH Sbjct: 475 DGCPKPH 481
>NLTP1_PHAAU (P83434) Nonspecific lipid-transfer protein 1 (LTP 1) (NS-LTP1)| Length = 91 Score = 30.4 bits (67), Expect = 2.7 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = -3 Query: 300 ADLRCLCSYKNSPWLSLYNIDPKRAMELPAKCGLTTP 190 AD R +CS + ++ I+P A LP KCG+ P Sbjct: 42 ADRRAVCSCLKAAAGAVRGINPNNAEALPGKCGVNIP 78
>PP2A2_ARATH (Q07099) Serine/threonine-protein phosphatase PP2A-2 catalytic| subunit (EC 3.1.3.16) Length = 306 Score = 29.3 bits (64), Expect = 6.1 Identities = 16/53 (30%), Positives = 25/53 (47%) Frame = -3 Query: 318 CATLGKADLRCLCSYKNSPWLSLYNIDPKRAMELPAKCGLTTPPDC*IQFHGM 160 C LG+AD++ LC + + YN+ P KC +T D QF+ + Sbjct: 17 CKPLGEADVKILCDQAKAILVEEYNVQ-------PVKCPVTVCGDIHGQFYDL 62
>TNFL6_RAT (P36940) Tumor necrosis factor ligand superfamily member 6 (Fas| antigen ligand) (Fas ligand) (CD178 antigen) (CD95L protein) [Contains: Tumor necrosis factor ligand superfamily member 6, membrane form; Tumor necrosis factor ligand superfamily m Length = 278 Score = 28.9 bits (63), Expect = 7.9 Identities = 15/41 (36%), Positives = 22/41 (53%) Frame = +2 Query: 53 VHTFEEEVAFPSMSTSNVTHGSVVHYTSSSRLEARGIPWNW 175 V +FE+++A PS + SV H T + R +R IP W Sbjct: 121 VSSFEKQIANPSTPSETKKPRSVAHLTGNPR--SRSIPLEW 159
>NLTP1_PRUDO (P82534) Nonspecific lipid-transfer protein 1 (LTP 1) (Major| allergen Pru d 3) Length = 91 Score = 28.9 bits (63), Expect = 7.9 Identities = 13/37 (35%), Positives = 18/37 (48%) Frame = -3 Query: 300 ADLRCLCSYKNSPWLSLYNIDPKRAMELPAKCGLTTP 190 AD R C+ S+ ++P A LP KCG+ P Sbjct: 42 ADRRAACNCLKQLSGSIPGVNPNNAAALPGKCGVNVP 78
>NLTP2_ORYSA (Q42978) Nonspecific lipid-transfer protein 2 precursor (LTP 2)| Length = 118 Score = 28.9 bits (63), Expect = 7.9 Identities = 17/55 (30%), Positives = 25/55 (45%), Gaps = 8/55 (14%) Frame = -3 Query: 330 SEACC--------ATLGKADLRCLCSYKNSPWLSLYNIDPKRAMELPAKCGLTTP 190 S ACC A AD R C+ + S+ ++ A +P+KCG+T P Sbjct: 51 SAACCSGVRSLNSAASTTADRRTACNCLKNVAGSISGLNAGNAASIPSKCGVTIP 105 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 50,737,733 Number of Sequences: 219361 Number of extensions: 938832 Number of successful extensions: 2236 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2213 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2236 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3523384522 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)