Clone Name | rbart24g03 |
---|---|
Clone Library Name | barley_pub |
>RETO_ESCCA (P30986) Reticuline oxidase precursor (EC 1.21.3.3)| (Berberine-bridge-forming enzyme) (BBE) (Tetrahydroprotoberberine synthase) Length = 538 Score = 105 bits (261), Expect = 9e-23 Identities = 54/128 (42%), Positives = 76/128 (59%), Gaps = 8/128 (6%) Frame = -3 Query: 493 GFMGSVPTDATPYPHRSGVLYNVQYMVFW---QGDGGTAANTWLGNLYDFMGQYVSKNPR 323 G M + +D TP+PHRSG V+Y+V W + T WL +Y+FM +VSKNPR Sbjct: 394 GQMSKISSDFTPFPHRSGTRLMVEYIVAWNQSEQKKKTEFLDWLEKVYEFMKPFVSKNPR 453 Query: 322 QAYVNYRDLDIG-----QNVVVDDATTFDSAKVWGEQYFTSNFQRLAAVKAAVDPTDYFR 158 YVN+ DLD+G VV++A + ++ WGE YF SN++RL K +DP + F Sbjct: 454 LGYVNHIDLDLGGIDWGNKTVVNNA--IEISRSWGESYFLSNYERLIRAKTLIDPNNVFN 511 Query: 157 NEQSIPPL 134 + QSIPP+ Sbjct: 512 HPQSIPPM 519
>RETO_PAPSO (P93479) Reticuline oxidase precursor (EC 1.21.3.3)| (Berberine-bridge-forming enzyme) (BBE) (Tetrahydroprotoberberine synthase) Length = 535 Score = 104 bits (259), Expect = 1e-22 Identities = 49/128 (38%), Positives = 77/128 (60%), Gaps = 6/128 (4%) Frame = -3 Query: 493 GFMGSVPTDATPYPHRSGVLYNVQYMVFWQGDGGTAA---NTWLGNLYDFMGQYVSKNPR 323 G M + TD TP+PHR G +Y++ W D + + WL YD++ +VSK PR Sbjct: 398 GKMSEISTDFTPFPHRKGTKLMFEYIIAWNQDEESKIGEFSEWLAKFYDYLEPFVSKEPR 457 Query: 322 QAYVNYRDLDIGQNVVVDDATTFDSAKV---WGEQYFTSNFQRLAAVKAAVDPTDYFRNE 152 YVN+ DLDIG + ++T ++ ++ WGE+YF+SN++RL K +DP + F + Sbjct: 458 VGYVNHIDLDIGGIDWRNKSSTTNAVEIARNWGERYFSSNYERLVKAKTLIDPNNVFNHP 517 Query: 151 QSIPPLVQ 128 QSIPP+++ Sbjct: 518 QSIPPMMK 525
>MCRA_STRLA (P43485) Mitomycin radical oxidase (EC 1.5.3.-)| Length = 447 Score = 31.6 bits (70), Expect = 1.2 Identities = 15/30 (50%), Positives = 19/30 (63%) Frame = -3 Query: 226 YFTSNFQRLAAVKAAVDPTDYFRNEQSIPP 137 Y ++F RL AVKA DP + FR +IPP Sbjct: 413 YTPADFARLRAVKAQYDPDNMFRVNFNIPP 442
>FUSB_BURCE (P24127) Fusaric acid resistance protein fusB| Length = 142 Score = 31.6 bits (70), Expect = 1.2 Identities = 15/40 (37%), Positives = 22/40 (55%), Gaps = 3/40 (7%) Frame = +1 Query: 325 SGSCSRTAP*S---RTSCRARCSPPCPRHPARTPCTGRCT 435 S CSR++ R+ C +RC+PP PR A + T C+ Sbjct: 97 SSGCSRSSRSCSCWRSPCGSRCAPPAPRATATSAVTASCS 136
>YXXB_BACSU (P39139) Hypothetical protein yxxB| Length = 289 Score = 30.4 bits (67), Expect = 2.7 Identities = 18/70 (25%), Positives = 33/70 (47%), Gaps = 1/70 (1%) Frame = -3 Query: 445 SGVLYNVQYMVFWQGDGGTAANTWLGN-LYDFMGQYVSKNPRQAYVNYRDLDIGQNVVVD 269 + + +N VF QGDGGT+ TW L GQ+++ ++ + + + V Sbjct: 117 TSIAWNALRFVFGQGDGGTSEQTWSAYVLAQPFGQWLTGLTGAGFIVFAIVQFMKGVRAA 176 Query: 268 DATTFDSAKV 239 FD++K+ Sbjct: 177 FMKEFDTSKM 186
>ZNFX1_MOUSE (Q8R151) NFX1-type zinc finger-containing protein 1| Length = 1909 Score = 30.0 bits (66), Expect = 3.5 Identities = 16/43 (37%), Positives = 17/43 (39%), Gaps = 10/43 (23%) Frame = +1 Query: 334 CSRTAP*SRTSC-----RARCSPPCPR-----HPARTPCTGRC 432 C P S SC RC PC R H + PCTG C Sbjct: 1433 CGHPCPGSCHSCFEGRFHERCQQPCKRLLICSHKCQEPCTGEC 1475
>HELS_PYRAB (Q9V0A9) Putative ski2-type helicase (EC 3.6.1.-)| Length = 715 Score = 29.3 bits (64), Expect = 6.0 Identities = 15/41 (36%), Positives = 20/41 (48%) Frame = -3 Query: 478 VPTDATPYPHRSGVLYNVQYMVFWQGDGGTAANTWLGNLYD 356 + +D P R GV Y Q VFW+ G N+W +YD Sbjct: 194 IRSDWRPVKLRKGVFY--QGFVFWEDGGSERYNSWEELVYD 232
>GLPK_MOUSE (Q64516) Glycerol kinase (EC 2.7.1.30) (ATP:glycerol| 3-phosphotransferase) (Glycerokinase) (GK) Length = 524 Score = 29.3 bits (64), Expect = 6.0 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = +2 Query: 143 DALLVSEVVGGIHGRLHCREPLEVAREVL 229 D+ L+ + GGIHG +HC + +R +L Sbjct: 179 DSWLIWSLTGGIHGGVHCTDVTNASRTML 207
>CATB_CHICK (P43233) Cathepsin B precursor (EC 3.4.22.1) (Cathepsin B1)| [Contains: Cathepsin B light chain; Cathepsin B heavy chain] Length = 340 Score = 29.3 bits (64), Expect = 6.0 Identities = 13/26 (50%), Positives = 14/26 (53%), Gaps = 2/26 (7%) Frame = +1 Query: 355 SRTSCRARCSPPCPRH--PARTPCTG 426 S CRA PPC H +R PCTG Sbjct: 175 SHVGCRAYTIPPCEHHVNGSRPPCTG 200
>BXB_CLOBO (P10844) Botulinum neurotoxin type B precursor (EC 3.4.24.69)| (BoNT/B) (Bontoxilysin B) [Contains: Botulinum neurotoxin B light chain; Botulinum neurotoxin B heavy chain] Length = 1290 Score = 28.9 bits (63), Expect = 7.8 Identities = 17/60 (28%), Positives = 34/60 (56%), Gaps = 4/60 (6%) Frame = -3 Query: 439 VLYNVQYMVFWQGDGGTAANTWLGNLYDF-MGQYVSK---NPRQAYVNYRDLDIGQNVVV 272 ++YN +Y +F G+ N+++ D +G+ +++ N Y+NYRDL IG+ ++ Sbjct: 1091 LMYNKEYYMFNAGN----KNSYIKLKKDSPVGEILTRSKYNQNSKYINYRDLYIGEKFII 1146
>HDNO_ARTOX (P08159) 6-hydroxy-D-nicotine oxidase (EC 1.5.3.6) (6-HDNO)| Length = 458 Score = 28.9 bits (63), Expect = 7.8 Identities = 15/38 (39%), Positives = 22/38 (57%) Frame = -3 Query: 250 SAKVWGEQYFTSNFQRLAAVKAAVDPTDYFRNEQSIPP 137 +A++ E Y + RLAAVK DP + FR+ +I P Sbjct: 418 TAEMVAEVYKPEVYCRLAAVKREYDPENRFRHNYNIDP 455
>BGAL_LACDE (P20043) Beta-galactosidase (EC 3.2.1.23) (Lactase)| Length = 1006 Score = 28.9 bits (63), Expect = 7.8 Identities = 17/46 (36%), Positives = 21/46 (45%) Frame = -3 Query: 430 NVQYMVFWQGDGGTAANTWLGNLYDFMGQYVSKNPRQAYVNYRDLD 293 N++ F Q W G+ F Q SKNP +YV Y DLD Sbjct: 91 NLELQGFGQPQYVNVQYPWDGSEEIFPPQIPSKNPLASYVRYFDLD 136
>Y703_ENCCU (Q8ST93) Hypothetical protein ECU07_0030/ECU09_2040| Length = 236 Score = 28.9 bits (63), Expect = 7.8 Identities = 15/34 (44%), Positives = 17/34 (50%), Gaps = 2/34 (5%) Frame = +1 Query: 322 ASGSCSRTA--P*SRTSCRARCSPPCPRHPARTP 417 AS RTA P R SC+ + PC HP R P Sbjct: 82 ASNRAHRTAKHPARRQSCKLKAPNPCVGHPLRIP 115 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 72,771,455 Number of Sequences: 219361 Number of extensions: 1423414 Number of successful extensions: 4688 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 4474 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4679 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3465624120 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)