Clone Name | rbart24f05 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | APOA1_SALSA (P27007) Apolipoprotein A-I precursor (Apo-AI) (ApoA-I) | 28 | 6.3 | 2 | SP5B_BACSU (Q00758) Stage V sporulation protein B | 28 | 8.2 | 3 | SYM_METTH (O26687) Methionyl-tRNA synthetase (EC 6.1.1.10) (Meth... | 28 | 8.2 | 4 | GP112_HUMAN (Q8IZF6) Probable G-protein coupled receptor 112 | 28 | 8.2 |
---|
>APOA1_SALSA (P27007) Apolipoprotein A-I precursor (Apo-AI) (ApoA-I)| Length = 258 Score = 28.1 bits (61), Expect = 6.3 Identities = 13/22 (59%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = +3 Query: 162 SRWAVPASRPSSSSW-GPHPSA 224 +RWA P RPS SSW PSA Sbjct: 235 ARWAPPPRRPSKSSWLSTRPSA 256
>SP5B_BACSU (Q00758) Stage V sporulation protein B| Length = 518 Score = 27.7 bits (60), Expect = 8.2 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +3 Query: 51 LLGMYQGETGSLLYLLVC*NFSGRIISTQHPIMSLRGSR 167 +L GE SLLYL VC + I +H + S++ + Sbjct: 188 MLSSVAGELASLLYLFVCFKYKKTIKIRKHFLQSIKNGK 226
>SYM_METTH (O26687) Methionyl-tRNA synthetase (EC 6.1.1.10) (Methionine--tRNA| ligase) (MetRS) Length = 651 Score = 27.7 bits (60), Expect = 8.2 Identities = 15/43 (34%), Positives = 21/43 (48%), Gaps = 9/43 (20%) Frame = +2 Query: 53 IGYVSR---------RDWESAVSSGMLKFLGEDNIYTTSHHEL 154 +GY+S RDW SG + F+G+D IY HH + Sbjct: 257 LGYISSAAAWSKKTGRDWREYWDSGAIHFIGKDIIY---HHAI 296
>GP112_HUMAN (Q8IZF6) Probable G-protein coupled receptor 112| Length = 2799 Score = 27.7 bits (60), Expect = 8.2 Identities = 14/32 (43%), Positives = 21/32 (65%) Frame = -1 Query: 174 LPTATLSSS*WDVV*ILSSPRNFSIPEDTADS 79 LP++T++SS W+ + SSP IP+ T DS Sbjct: 2083 LPSSTITSS-WNRIPTASSPSTLIIPKPTLDS 2113 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36,718,203 Number of Sequences: 219361 Number of extensions: 654059 Number of successful extensions: 1864 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1840 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1863 length of database: 80,573,946 effective HSP length: 56 effective length of database: 68,289,730 effective search space used: 1638953520 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)