Clone Name | rbart24e11 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | AGL11_ARATH (Q38836) Agamous-like MADS-box protein AGL11 | 29 | 3.1 |
---|
>AGL11_ARATH (Q38836) Agamous-like MADS-box protein AGL11| Length = 230 Score = 28.9 bits (63), Expect = 3.1 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -2 Query: 302 TKAKLFRRFHQHHHAHDSENEVDEVEELARK 210 TK R+ QHHH S +E++ +E LA + Sbjct: 169 TKVAEVERYQQHHHQMVSGSEINAIEALASR 199 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 30,744,211 Number of Sequences: 219361 Number of extensions: 359370 Number of successful extensions: 1807 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1519 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1741 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 1365190992 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)