Clone Name | rbart24d11 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | TUB_HUMAN (P50607) Tubby protein homolog | 36 | 0.026 | 2 | TUB_RAT (O88808) Tubby protein homolog | 35 | 0.057 | 3 | TUB_MOUSE (P50586) Tubby protein | 35 | 0.057 | 4 | TULP3_MOUSE (O88413) Tubby-related protein 3 (Tubby-like protein 3) | 33 | 0.13 | 5 | NU170_YEAST (P38181) Nucleoporin NUP170 (Nuclear pore protein NU... | 29 | 2.4 | 6 | TULP3_HUMAN (O75386) Tubby-related protein 3 (Tubby-like protein 3) | 28 | 5.4 | 7 | JHD2C_MOUSE (Q69ZK6) Probable JmjC domain-containing histone dem... | 27 | 9.2 |
---|
>TUB_HUMAN (P50607) Tubby protein homolog| Length = 506 Score = 35.8 bits (81), Expect = 0.026 Identities = 21/59 (35%), Positives = 29/59 (49%) Frame = -1 Query: 185 ASKSESEMCKHGQESVSVLAKKPIMNADAGHTSSVIVPNMNVPHQRIKNKDCNTHEPLL 9 AS S E QE +V + ++ SVIVP MN+ H+R+ + N HE LL Sbjct: 353 ASSSTLESGTLRQELAAVCYETNVLGFKGPRKMSVIVPGMNMVHERVSIRPRNEHETLL 411
>TUB_RAT (O88808) Tubby protein homolog| Length = 505 Score = 34.7 bits (78), Expect = 0.057 Identities = 21/59 (35%), Positives = 29/59 (49%) Frame = -1 Query: 185 ASKSESEMCKHGQESVSVLAKKPIMNADAGHTSSVIVPNMNVPHQRIKNKDCNTHEPLL 9 AS S E QE +V + ++ SVIVP MN+ H+R+ + N HE LL Sbjct: 352 ASSSTLESGTLRQELAAVCYETNVLGFKGPRKMSVIVPGMNMVHERVCIRPRNEHETLL 410
>TUB_MOUSE (P50586) Tubby protein| Length = 505 Score = 34.7 bits (78), Expect = 0.057 Identities = 21/59 (35%), Positives = 29/59 (49%) Frame = -1 Query: 185 ASKSESEMCKHGQESVSVLAKKPIMNADAGHTSSVIVPNMNVPHQRIKNKDCNTHEPLL 9 AS S E QE +V + ++ SVIVP MN+ H+R+ + N HE LL Sbjct: 352 ASSSTLESGTLRQELAAVCYETNVLGFKGPRKMSVIVPGMNMVHERVCIRPRNEHETLL 410
>TULP3_MOUSE (O88413) Tubby-related protein 3 (Tubby-like protein 3)| Length = 460 Score = 33.5 bits (75), Expect = 0.13 Identities = 16/47 (34%), Positives = 25/47 (53%) Frame = -1 Query: 149 QESVSVLAKKPIMNADAGHTSSVIVPNMNVPHQRIKNKDCNTHEPLL 9 QE ++ + ++ SVI+P MN+ H+RI + N HE LL Sbjct: 319 QELAAICYETNVLGFKGPRKMSVIIPGMNMNHERIPFRPRNEHESLL 365
>NU170_YEAST (P38181) Nucleoporin NUP170 (Nuclear pore protein NUP170)| Length = 1502 Score = 29.3 bits (64), Expect = 2.4 Identities = 20/61 (32%), Positives = 31/61 (50%), Gaps = 1/61 (1%) Frame = -1 Query: 191 SLASKSESEMCKHGQESVSVLAKKPIMNADA-GHTSSVIVPNMNVPHQRIKNKDCNTHEP 15 S A+K++ + H S + P+M A A G TS I PNM+ ++ I+ T +P Sbjct: 42 SSATKAQQQPT-HILNSYPITGSNPLMRASAMGATSGSINPNMSNMNEHIRVSGMGTSKP 100 Query: 14 L 12 L Sbjct: 101 L 101
>TULP3_HUMAN (O75386) Tubby-related protein 3 (Tubby-like protein 3)| Length = 442 Score = 28.1 bits (61), Expect = 5.4 Identities = 13/47 (27%), Positives = 24/47 (51%) Frame = -1 Query: 149 QESVSVLAKKPIMNADAGHTSSVIVPNMNVPHQRIKNKDCNTHEPLL 9 QE ++ + ++ SVI+P M + H++I + N H+ LL Sbjct: 301 QELAAISYETNVLGFKGPRKMSVIIPGMTLNHKQIPYQPQNNHDSLL 347
>JHD2C_MOUSE (Q69ZK6) Probable JmjC domain-containing histone demethylation| protein 2C (EC 1.14.11.-) (Jumonji domain-containing protein 1C) Length = 2350 Score = 27.3 bits (59), Expect = 9.2 Identities = 12/52 (23%), Positives = 26/52 (50%) Frame = -1 Query: 191 SLASKSESEMCKHGQESVSVLAKKPIMNADAGHTSSVIVPNMNVPHQRIKNK 36 S+ S+ +C+ + K + +AG T +I+PN+N+ +K++ Sbjct: 1131 SVPLASKDRVCERSSSGAN---KTDYLKPEAGETGRIILPNVNLESAHVKSE 1179 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,200,414 Number of Sequences: 219361 Number of extensions: 652930 Number of successful extensions: 1423 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1396 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1423 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 1396778976 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)