Clone Name | rbart24a08 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | ZNF77_HUMAN (Q15935) Zinc finger protein 77 (ZNFpT1) | 30 | 2.8 | 2 | RPOC2_SPIOL (P11704) DNA-directed RNA polymerase beta'' chain (E... | 29 | 8.2 |
---|
>ZNF77_HUMAN (Q15935) Zinc finger protein 77 (ZNFpT1)| Length = 545 Score = 30.4 bits (67), Expect = 2.8 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = -3 Query: 495 CYCALQNHFRWQEGSGTCEARCCGEEAQCHGS 400 CY + ++H R G C+ + CG+ C+ S Sbjct: 307 CYSSFRDHVRTHTGEKPCQCKHCGKAFTCYSS 338
>RPOC2_SPIOL (P11704) DNA-directed RNA polymerase beta'' chain (EC 2.7.7.6)| (PEP) (Plastid-encoded RNA polymerase beta'' subunit) (RNA polymerase beta'' subunit) Length = 1361 Score = 28.9 bits (63), Expect = 8.2 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = -2 Query: 112 YQMKLERIF*YLDDVHLLSGDCTWLNHNES 23 YQMK++R F ++VH+L+G + + N S Sbjct: 652 YQMKVDRFFFIPEEVHILAGSSSIMVRNNS 681 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 56,364,475 Number of Sequences: 219361 Number of extensions: 896339 Number of successful extensions: 2257 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2179 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2257 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3638905326 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)