Clone Name | rbart23h11 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | Y1269_PYRHO (O58984) Hypothetical UPF0098 protein PH1269 | 29 | 3.6 | 2 | ATM_ASPOR (Q2U639) Serine/threonine-protein kinase tel1 (EC 2.7.... | 28 | 8.1 |
---|
>Y1269_PYRHO (O58984) Hypothetical UPF0098 protein PH1269| Length = 198 Score = 28.9 bits (63), Expect = 3.6 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +3 Query: 180 GDGNHHAHIQFRAVDLS*SIKPGHSR 257 G G HH H + A+D + ++KPG SR Sbjct: 149 GHGVHHYHFKVYALDTTLNLKPGASR 174
>ATM_ASPOR (Q2U639) Serine/threonine-protein kinase tel1 (EC 2.7.11.1)| (DNA-damage checkpoint kinase tel1) (Telomere length regulation protein 1) (ATM homolog) Length = 2925 Score = 27.7 bits (60), Expect = 8.1 Identities = 15/45 (33%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = -2 Query: 160 ELVRLLPTHHVSVDCIIGTPTTLLQLVDMIIGPT-VFLSWTYLDL 29 +L+ L+P HH SVD + LL+L+ I+ + SWT + + Sbjct: 449 QLIPLIPRHHASVD---SKSSLLLRLLPNILDENGILASWTMITI 490 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,258,043 Number of Sequences: 219361 Number of extensions: 650193 Number of successful extensions: 1137 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1136 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1137 length of database: 80,573,946 effective HSP length: 63 effective length of database: 66,754,203 effective search space used: 1602100872 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)