Clone Name | rbart23h04 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | SPEG_HUMAN (Q15772) Striated muscle preferentially expressed pro... | 33 | 0.53 | 2 | CFAB_HUMAN (P00751) Complement factor B precursor (EC 3.4.21.47)... | 29 | 5.9 |
---|
>SPEG_HUMAN (Q15772) Striated muscle preferentially expressed protein kinase (EC| 2.7.11.1) (Aortic preferentially expressed protein 1) (APEG-1) Length = 3223 Score = 32.7 bits (73), Expect = 0.53 Identities = 21/64 (32%), Positives = 25/64 (39%) Frame = -2 Query: 332 EDGRSPERTPHEAEVVELVAYATYPYGYTRGSRGTTSRASWAVRRTPRAGPRALQRGYSN 153 E GR+P + L + P RG R S A PRAGPR L RG Sbjct: 1975 EQGRAPSQDQEAPSPEALPSPGQEPAAGASPRRGELRRGSSAESALPRAGPRELGRGLHK 2034 Query: 152 GVSM 141 S+ Sbjct: 2035 AASV 2038
>CFAB_HUMAN (P00751) Complement factor B precursor (EC 3.4.21.47) (C3/C5| convertase) (Properdin factor B) (Glycine-rich beta glycoprotein) (GBG) (PBF2) [Contains: Complement factor B Ba fragment; Complement factor B Bb fragment] Length = 764 Score = 29.3 bits (64), Expect = 5.9 Identities = 19/75 (25%), Positives = 31/75 (41%), Gaps = 2/75 (2%) Frame = -2 Query: 281 LVAYATYPYGYTRGSRGTTSRASWAVRRTPRAG--PRALQRGYSNGVSMRGVDW*VLEAC 108 LV YATYP + + S +S A W ++ L+ G + +++ V Sbjct: 311 LVTYATYPKIWVKVSEADSSNADWVTKQLNEINYEDHKLKSGTNTKKALQAV-------Y 363 Query: 107 NGCRWATDVPVTSWS 63 + W DVP W+ Sbjct: 364 SMMSWPDDVPPEGWN 378 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 60,348,769 Number of Sequences: 219361 Number of extensions: 1068535 Number of successful extensions: 3226 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3157 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3226 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3420806017 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)