Clone Name | rbart23g05 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | AT8B1_HUMAN (O43520) Probable phospholipid-transporting ATPase I... | 30 | 1.2 | 2 | MATK_CICAR (Q5YK05) Maturase K (Intron maturase) | 28 | 6.2 |
---|
>AT8B1_HUMAN (O43520) Probable phospholipid-transporting ATPase IC (EC 3.6.3.1)| (Familial intrahepatic cholestasis type 1) (ATPase class I type 8B member 1) Length = 1251 Score = 30.4 bits (67), Expect = 1.2 Identities = 17/56 (30%), Positives = 24/56 (42%) Frame = +1 Query: 34 QQCTHSSSGNPLAISIGPWINYFCIHKSTKRARTLLESRNPTVARRRSTTSSQQEM 201 Q+ GN I G W+N + K TKR + L T RR T S++ + Sbjct: 787 QESFFPPGGNRALIITGSWLNEILLEKKTKRNKILKLKFPRTEEERRMRTQSKRRL 842
>MATK_CICAR (Q5YK05) Maturase K (Intron maturase)| Length = 509 Score = 28.1 bits (61), Expect = 6.2 Identities = 16/39 (41%), Positives = 20/39 (51%), Gaps = 4/39 (10%) Frame = +2 Query: 26 QSVSSAHILAVEIPLQFQSGLGL----IISAYTNQPSVH 130 Q +S + VEIP QSG L II +Y N S+H Sbjct: 92 QIISEGFAIVVEIPFFLQSGSSLKESEIIKSYKNLRSIH 130 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 38,587,032 Number of Sequences: 219361 Number of extensions: 665881 Number of successful extensions: 1404 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1394 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1403 length of database: 80,573,946 effective HSP length: 62 effective length of database: 66,973,564 effective search space used: 1607365536 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)