ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbart23f02 |
|---|---|
| Clone Library Name | barley_pub |
>RPB1_ARATH (P18616) DNA-directed RNA polymerase II largest subunit (EC 2.7.7.6)| Length = 1840 Score = 35.8 bits (81), Expect = 0.028 Identities = 16/63 (25%), Positives = 28/63 (44%) Frame = +2 Query: 131 GYDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGM 310 GY PGY G+ +P Y+ +P Y +P+Y P ++ P++ +P Sbjct: 1558 GYSPTSPGYSPTSPGYSPTSPTYSPSSPGYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSP 1617 Query: 311 VAP 319 +P Sbjct: 1618 TSP 1620 Score = 35.4 bits (80), Expect = 0.036 Identities = 16/63 (25%), Positives = 27/63 (42%) Frame = +2 Query: 131 GYDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGM 310 GY PGY G+ +P Y+ +P Y +P Y P ++ P++ +P Sbjct: 1551 GYSPTSPGYSPTSPGYSPTSPGYSPTSPTYSPSSPGYSPTSPAYSPTSPSYSPTSPSYSP 1610 Query: 311 VAP 319 +P Sbjct: 1611 TSP 1613 Score = 35.0 bits (79), Expect = 0.047 Identities = 17/63 (26%), Positives = 28/63 (44%) Frame = +2 Query: 131 GYDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGM 310 GY PGY G+ +P Y+ +P Y +P+Y PG++ P + +P Sbjct: 1544 GYSPSSPGYSPTSPGYSPTSPGYSPTSPGYSPTSPTYSPSSPGYSPTSPAYSPTSPSYSP 1603 Query: 311 VAP 319 +P Sbjct: 1604 TSP 1606 Score = 33.9 bits (76), Expect = 0.11 Identities = 15/62 (24%), Positives = 27/62 (43%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +P+Y PG++ P++ +P G Sbjct: 1664 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPAYSPTSPGYSPTSPSYSPTSPSYGPT 1723 Query: 314 AP 319 +P Sbjct: 1724 SP 1725 Score = 33.9 bits (76), Expect = 0.11 Identities = 16/63 (25%), Positives = 27/63 (42%) Frame = +2 Query: 131 GYDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGM 310 GY PGY + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 1565 GYSPTSPGYSPTSPTYSPSSPGYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSP 1624 Query: 311 VAP 319 +P Sbjct: 1625 TSP 1627 Score = 33.5 bits (75), Expect = 0.14 Identities = 16/63 (25%), Positives = 27/63 (42%) Frame = +2 Query: 131 GYDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGM 310 GY P Y G+ +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 1572 GYSPTSPTYSPSSPGYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSP 1631 Query: 311 VAP 319 +P Sbjct: 1632 TSP 1634 Score = 32.7 bits (73), Expect = 0.23 Identities = 15/63 (23%), Positives = 26/63 (41%) Frame = +2 Query: 131 GYDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGM 310 GY P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 1586 GYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPAYSP 1645 Query: 311 VAP 319 +P Sbjct: 1646 TSP 1648 Score = 32.3 bits (72), Expect = 0.31 Identities = 14/57 (24%), Positives = 25/57 (43%) Frame = +2 Query: 149 PGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMVAP 319 PGY + +P Y+ +P Y +PSY P ++ P++ +P +P Sbjct: 1585 PGYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSP 1641 Score = 31.6 bits (70), Expect = 0.52 Identities = 15/62 (24%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P + +PG Sbjct: 1650 YSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPAYSPTSPGYSPT 1709 Query: 314 AP 319 +P Sbjct: 1710 SP 1711 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 1643 YSPTSPAYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPAYSPT 1702 Query: 314 AP 319 +P Sbjct: 1703 SP 1704 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 1636 YSPTSPAYSPTSPAYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT 1695 Query: 314 AP 319 +P Sbjct: 1696 SP 1697 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 1629 YSPTSPSYSPTSPAYSPTSPAYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT 1688 Query: 314 AP 319 +P Sbjct: 1689 SP 1690 Score = 30.0 bits (66), Expect = 1.5 Identities = 14/62 (22%), Positives = 24/62 (38%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P + +P Sbjct: 1657 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPAYSPTSPGYSPTSPSYSPT 1716 Query: 314 AP 319 +P Sbjct: 1717 SP 1718 Score = 29.6 bits (65), Expect = 2.0 Identities = 14/57 (24%), Positives = 24/57 (42%) Frame = +2 Query: 149 PGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMVAP 319 PGY G+ +P Y+ +P Y +P Y P ++ P + +P +P Sbjct: 1543 PGYSPSSPGYSPTSPGYSPTSPGYSPTSPGYSPTSPTYSPSSPGYSPTSPAYSPTSP 1599 Score = 29.3 bits (64), Expect = 2.6 Identities = 13/62 (20%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +P+Y P ++ P++ +P Sbjct: 1622 YSPTSPSYSPTSPSYSPTSPAYSPTSPAYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPT 1681 Query: 314 AP 319 +P Sbjct: 1682 SP 1683 Score = 29.3 bits (64), Expect = 2.6 Identities = 13/62 (20%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +P+Y P ++ P++ +P Sbjct: 1615 YSPTSPSYSPTSPSYSPTSPSYSPTSPAYSPTSPAYSPTSPAYSPTSPSYSPTSPSYSPT 1674 Query: 314 AP 319 +P Sbjct: 1675 SP 1676 Score = 29.3 bits (64), Expect = 2.6 Identities = 14/62 (22%), Positives = 24/62 (38%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P + +P Sbjct: 1601 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPAYSPTSPAYSPTSPAYSPT 1660 Query: 314 AP 319 +P Sbjct: 1661 SP 1662 Score = 29.3 bits (64), Expect = 2.6 Identities = 14/62 (22%), Positives = 24/62 (38%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P + +P Sbjct: 1594 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPAYSPTSPAYSPT 1653 Query: 314 AP 319 +P Sbjct: 1654 SP 1655 Score = 28.1 bits (61), Expect = 5.8 Identities = 13/62 (20%), Positives = 24/62 (38%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +P+Y P ++ P + +P Sbjct: 1608 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPAYSPTSPAYSPTSPAYSPTSPSYSPT 1667 Query: 314 AP 319 +P Sbjct: 1668 SP 1669
>RPB1_YEAST (P04050) DNA-directed RNA polymerase II largest subunit (EC 2.7.7.6)| (RNA polymerase II subunit 1) (B220) Length = 1733 Score = 32.3 bits (72), Expect = 0.31 Identities = 15/62 (24%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ PN+ +P Sbjct: 1647 YSPTSPSYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPSYSPT 1706 Query: 314 AP 319 +P Sbjct: 1707 SP 1708 Score = 31.6 bits (70), Expect = 0.52 Identities = 15/62 (24%), Positives = 26/62 (41%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +PG Sbjct: 1654 YSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPSYSPTSPGYSPG 1713 Query: 314 AP 319 +P Sbjct: 1714 SP 1715 Score = 31.6 bits (70), Expect = 0.52 Identities = 14/57 (24%), Positives = 26/57 (45%) Frame = +2 Query: 149 PGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMVAP 319 PG+ + G +P Y+ +P Y +PSY P ++ P++ +P +P Sbjct: 1533 PGFGVSSPGFSPTSPTYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSP 1589 Score = 31.2 bits (69), Expect = 0.68 Identities = 14/63 (22%), Positives = 27/63 (42%) Frame = +2 Query: 131 GYDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGM 310 G+ PG+ + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 1534 GFGVSSPGFSPTSPTYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSP 1593 Query: 311 VAP 319 +P Sbjct: 1594 TSP 1596 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 1640 YSPTSPSYSPTSPSYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPNYSPT 1699 Query: 314 AP 319 +P Sbjct: 1700 SP 1701 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 1633 YSPTSPSYSPTSPSYSPTSPSYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT 1692 Query: 314 AP 319 +P Sbjct: 1693 SP 1694 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 1619 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPAYSPTSPSYSPTSPSYSPT 1678 Query: 314 AP 319 +P Sbjct: 1679 SP 1680 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 1605 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPAYSPT 1664 Query: 314 AP 319 +P Sbjct: 1665 SP 1666 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 1598 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT 1657 Query: 314 AP 319 +P Sbjct: 1658 SP 1659 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 1591 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT 1650 Query: 314 AP 319 +P Sbjct: 1651 SP 1652 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 1584 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT 1643 Query: 314 AP 319 +P Sbjct: 1644 SP 1645 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 1577 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT 1636 Query: 314 AP 319 +P Sbjct: 1637 SP 1638 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 1570 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT 1629 Query: 314 AP 319 +P Sbjct: 1630 SP 1631 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 1563 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT 1622 Query: 314 AP 319 +P Sbjct: 1623 SP 1624 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 1556 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT 1615 Query: 314 AP 319 +P Sbjct: 1616 SP 1617 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 1549 YSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT 1608 Query: 314 AP 319 +P Sbjct: 1609 SP 1610 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/63 (22%), Positives = 26/63 (41%) Frame = +2 Query: 131 GYDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGM 310 G+ P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 1541 GFSPTSPTYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSP 1600 Query: 311 VAP 319 +P Sbjct: 1601 TSP 1603 Score = 29.3 bits (64), Expect = 2.6 Identities = 13/62 (20%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +P+Y P ++ P++ +P Sbjct: 1626 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPT 1685 Query: 314 AP 319 +P Sbjct: 1686 SP 1687 Score = 29.3 bits (64), Expect = 2.6 Identities = 14/62 (22%), Positives = 24/62 (38%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P + +P Sbjct: 1612 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPAYSPTSPSYSPT 1671 Query: 314 AP 319 +P Sbjct: 1672 SP 1673
>RPB1_PLAFD (P14248) DNA-directed RNA polymerase II largest subunit (EC 2.7.7.6)| Length = 2452 Score = 32.3 bits (72), Expect = 0.31 Identities = 14/67 (20%), Positives = 31/67 (46%) Frame = +2 Query: 122 LTSGYDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPG 301 + S Y+ + P Y + + +P+Y+ +P+Y +P Y P ++ P + +P Sbjct: 2279 VNSQYNVMSPVYSVTSPKYSPTSPKYSPTSPKYSPTSPKYSPTSPKYSPTSPKYSPTSPK 2338 Query: 302 RGMVAPR 322 +P+ Sbjct: 2339 YSPTSPK 2345 Score = 28.9 bits (63), Expect = 3.4 Identities = 13/62 (20%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P+Y+ +P+Y +P Y P ++ P + +P Sbjct: 2290 YSVTSPKYSPTSPKYSPTSPKYSPTSPKYSPTSPKYSPTSPKYSPTSPKYSPTSPKYSPT 2349 Query: 314 AP 319 +P Sbjct: 2350 SP 2351
>RPB1_CRIGR (P11414) DNA-directed RNA polymerase II largest subunit (EC| 2.7.7.6) (RPB1) (Fragment) Length = 467 Score = 32.3 bits (72), Expect = 0.31 Identities = 15/62 (24%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ PN+ +P Sbjct: 224 YSPTSPSYSPTSPSYSPTSPNYSPTSPNYTPTSPSYSPTSPSYSPTSPNYTPTSPNYSPT 283 Query: 314 AP 319 +P Sbjct: 284 SP 285 Score = 32.0 bits (71), Expect = 0.40 Identities = 15/62 (24%), Positives = 23/62 (37%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y +P Y +PSY P + PN+ +P Sbjct: 231 YSPTSPSYSPTSPNYSPTSPNYTPTSPSYSPTSPSYSPTSPNYTPTSPNYSPTSPSYSPT 290 Query: 314 AP 319 +P Sbjct: 291 SP 292 Score = 32.0 bits (71), Expect = 0.40 Identities = 15/62 (24%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ PN+ +P Sbjct: 203 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPNYTPTSPSYSPT 262 Query: 314 AP 319 +P Sbjct: 263 SP 264 Score = 32.0 bits (71), Expect = 0.40 Identities = 15/63 (23%), Positives = 26/63 (41%) Frame = +2 Query: 131 GYDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGM 310 GY P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 104 GYTPQSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSP 163 Query: 311 VAP 319 +P Sbjct: 164 TSP 166 Score = 31.6 bits (70), Expect = 0.52 Identities = 15/62 (24%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ PN+ +P Sbjct: 196 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPNYTPT 255 Query: 314 AP 319 +P Sbjct: 256 SP 257 Score = 30.8 bits (68), Expect = 0.89 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 112 YSPTSPSYSPTSPSYSPTSPNYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT 171 Query: 314 AP 319 +P Sbjct: 172 SP 173 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 189 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPNYSPT 248 Query: 314 AP 319 +P Sbjct: 249 SP 250 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 182 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT 241 Query: 314 AP 319 +P Sbjct: 242 SP 243 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 175 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT 234 Query: 314 AP 319 +P Sbjct: 235 SP 236 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 168 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT 227 Query: 314 AP 319 +P Sbjct: 228 SP 229 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 161 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT 220 Query: 314 AP 319 +P Sbjct: 221 SP 222 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 154 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT 213 Query: 314 AP 319 +P Sbjct: 214 SP 215 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 147 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT 206 Query: 314 AP 319 +P Sbjct: 207 SP 208 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 140 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT 199 Query: 314 AP 319 +P Sbjct: 200 SP 201 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 133 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT 192 Query: 314 AP 319 +P Sbjct: 193 SP 194 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 126 YSPTSPNYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT 185 Query: 314 AP 319 +P Sbjct: 186 SP 187 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 119 YSPTSPSYSPTSPNYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT 178 Query: 314 AP 319 +P Sbjct: 179 SP 180 Score = 30.0 bits (66), Expect = 1.5 Identities = 14/63 (22%), Positives = 26/63 (41%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +P+Y P ++ P++ +P Sbjct: 245 YSPTSPNYTPTSPSYSPTSPSYSPTSPNYTPTSPNYSPTSPSYSPTSPSYSPTSPSYSPS 304 Query: 314 APR 322 +PR Sbjct: 305 SPR 307 Score = 29.6 bits (65), Expect = 2.0 Identities = 13/62 (20%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +P+Y P ++ P++ +P Sbjct: 217 YSPTSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPNYTPTSPSYSPTSPSYSPTSPNYTPT 276 Query: 314 AP 319 +P Sbjct: 277 SP 278 Score = 29.3 bits (64), Expect = 2.6 Identities = 15/62 (24%), Positives = 24/62 (38%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +PRY +P Y +PSY P ++ P + +P Sbjct: 287 YSPTSPSYSPTSPSYSPSSPRYTPQSPTYTPSSPSYSPSSPSYSPTSPKYTPTSPSYSPS 346 Query: 314 AP 319 +P Sbjct: 347 SP 348 Score = 29.3 bits (64), Expect = 2.6 Identities = 13/62 (20%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +P+Y P ++ P++ +P Sbjct: 238 YSPTSPNYSPTSPNYTPTSPSYSPTSPSYSPTSPNYTPTSPNYSPTSPSYSPTSPSYSPT 297 Query: 314 AP 319 +P Sbjct: 298 SP 299 Score = 28.9 bits (63), Expect = 3.4 Identities = 13/62 (20%), Positives = 24/62 (38%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +P+Y P + P++ +P Sbjct: 210 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPNYTPTSPSYSPTSPSYSPT 269 Query: 314 AP 319 +P Sbjct: 270 SP 271 Score = 28.5 bits (62), Expect = 4.4 Identities = 13/55 (23%), Positives = 24/55 (43%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAP 298 Y P Y + +P Y+ +PRY +P+Y P ++ P++ +P Sbjct: 280 YSPTSPSYSPTSPSYSPTSPSYSPSSPRYTPQSPTYTPSSPSYSPSSPSYSPTSP 334 Score = 27.3 bits (59), Expect = 9.9 Identities = 12/57 (21%), Positives = 22/57 (38%) Frame = +2 Query: 149 PGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMVAP 319 P Y + +P+Y +P Y +P Y P ++ P + +P +P Sbjct: 320 PSYSPSSPSYSPTSPKYTPTSPSYSPSSPEYTPTSPKYSPTSPKYSPTSPKYSPTSP 376
>RPB1_MOUSE (P08775) DNA-directed RNA polymerase II largest subunit (EC 2.7.7.6)| (RPB1) Length = 1970 Score = 32.3 bits (72), Expect = 0.31 Identities = 15/62 (24%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ PN+ +P Sbjct: 1727 YSPTSPSYSPTSPSYSPTSPNYSPTSPNYTPTSPSYSPTSPSYSPTSPNYTPTSPNYSPT 1786 Query: 314 AP 319 +P Sbjct: 1787 SP 1788 Score = 32.0 bits (71), Expect = 0.40 Identities = 15/62 (24%), Positives = 23/62 (37%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y +P Y +PSY P + PN+ +P Sbjct: 1734 YSPTSPSYSPTSPNYSPTSPNYTPTSPSYSPTSPSYSPTSPNYTPTSPNYSPTSPSYSPT 1793 Query: 314 AP 319 +P Sbjct: 1794 SP 1795 Score = 32.0 bits (71), Expect = 0.40 Identities = 15/62 (24%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ PN+ +P Sbjct: 1706 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPNYTPTSPSYSPT 1765 Query: 314 AP 319 +P Sbjct: 1766 SP 1767 Score = 32.0 bits (71), Expect = 0.40 Identities = 15/63 (23%), Positives = 26/63 (41%) Frame = +2 Query: 131 GYDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGM 310 GY P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 1607 GYTPQSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSP 1666 Query: 311 VAP 319 +P Sbjct: 1667 TSP 1669 Score = 31.6 bits (70), Expect = 0.52 Identities = 15/62 (24%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ PN+ +P Sbjct: 1699 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPNYTPT 1758 Query: 314 AP 319 +P Sbjct: 1759 SP 1760 Score = 30.8 bits (68), Expect = 0.89 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 1615 YSPTSPSYSPTSPSYSPTSPNYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT 1674 Query: 314 AP 319 +P Sbjct: 1675 SP 1676 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 1692 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPNYSPT 1751 Query: 314 AP 319 +P Sbjct: 1752 SP 1753 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 1685 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT 1744 Query: 314 AP 319 +P Sbjct: 1745 SP 1746 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 1678 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT 1737 Query: 314 AP 319 +P Sbjct: 1738 SP 1739 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 1671 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT 1730 Query: 314 AP 319 +P Sbjct: 1731 SP 1732 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 1664 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT 1723 Query: 314 AP 319 +P Sbjct: 1724 SP 1725 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 1657 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT 1716 Query: 314 AP 319 +P Sbjct: 1717 SP 1718 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 1650 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT 1709 Query: 314 AP 319 +P Sbjct: 1710 SP 1711 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 1643 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT 1702 Query: 314 AP 319 +P Sbjct: 1703 SP 1704 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 1636 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT 1695 Query: 314 AP 319 +P Sbjct: 1696 SP 1697 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 1629 YSPTSPNYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT 1688 Query: 314 AP 319 +P Sbjct: 1689 SP 1690 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 1622 YSPTSPSYSPTSPNYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT 1681 Query: 314 AP 319 +P Sbjct: 1682 SP 1683 Score = 30.0 bits (66), Expect = 1.5 Identities = 14/63 (22%), Positives = 26/63 (41%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +P+Y P ++ P++ +P Sbjct: 1748 YSPTSPNYTPTSPSYSPTSPSYSPTSPNYTPTSPNYSPTSPSYSPTSPSYSPTSPSYSPS 1807 Query: 314 APR 322 +PR Sbjct: 1808 SPR 1810 Score = 29.6 bits (65), Expect = 2.0 Identities = 13/62 (20%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +P+Y P ++ P++ +P Sbjct: 1720 YSPTSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPNYTPTSPSYSPTSPSYSPTSPNYTPT 1779 Query: 314 AP 319 +P Sbjct: 1780 SP 1781 Score = 29.3 bits (64), Expect = 2.6 Identities = 15/62 (24%), Positives = 24/62 (38%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +PRY +P Y +PSY P ++ P + +P Sbjct: 1790 YSPTSPSYSPTSPSYSPSSPRYTPQSPTYTPSSPSYSPSSPSYSPTSPKYTPTSPSYSPS 1849 Query: 314 AP 319 +P Sbjct: 1850 SP 1851 Score = 29.3 bits (64), Expect = 2.6 Identities = 13/62 (20%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +P+Y P ++ P++ +P Sbjct: 1741 YSPTSPNYSPTSPNYTPTSPSYSPTSPSYSPTSPNYTPTSPNYSPTSPSYSPTSPSYSPT 1800 Query: 314 AP 319 +P Sbjct: 1801 SP 1802 Score = 28.9 bits (63), Expect = 3.4 Identities = 13/62 (20%), Positives = 24/62 (38%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +P+Y P + P++ +P Sbjct: 1713 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPNYTPTSPSYSPTSPSYSPT 1772 Query: 314 AP 319 +P Sbjct: 1773 SP 1774 Score = 28.5 bits (62), Expect = 4.4 Identities = 13/55 (23%), Positives = 24/55 (43%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAP 298 Y P Y + +P Y+ +PRY +P+Y P ++ P++ +P Sbjct: 1783 YSPTSPSYSPTSPSYSPTSPSYSPSSPRYTPQSPTYTPSSPSYSPSSPSYSPTSP 1837 Score = 27.3 bits (59), Expect = 9.9 Identities = 12/57 (21%), Positives = 22/57 (38%) Frame = +2 Query: 149 PGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMVAP 319 P Y + +P+Y +P Y +P Y P ++ P + +P +P Sbjct: 1823 PSYSPSSPSYSPTSPKYTPTSPSYSPSSPEYTPASPKYSPTSPKYSPTSPKYSPTSP 1879
>RPB1_HUMAN (P24928) DNA-directed RNA polymerase II largest subunit (EC 2.7.7.6)| (RPB1) Length = 1970 Score = 32.3 bits (72), Expect = 0.31 Identities = 15/62 (24%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ PN+ +P Sbjct: 1727 YSPTSPSYSPTSPSYSPTSPNYSPTSPNYTPTSPSYSPTSPSYSPTSPNYTPTSPNYSPT 1786 Query: 314 AP 319 +P Sbjct: 1787 SP 1788 Score = 32.0 bits (71), Expect = 0.40 Identities = 15/62 (24%), Positives = 23/62 (37%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y +P Y +PSY P + PN+ +P Sbjct: 1734 YSPTSPSYSPTSPNYSPTSPNYTPTSPSYSPTSPSYSPTSPNYTPTSPNYSPTSPSYSPT 1793 Query: 314 AP 319 +P Sbjct: 1794 SP 1795 Score = 32.0 bits (71), Expect = 0.40 Identities = 15/62 (24%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ PN+ +P Sbjct: 1706 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPNYTPTSPSYSPT 1765 Query: 314 AP 319 +P Sbjct: 1766 SP 1767 Score = 32.0 bits (71), Expect = 0.40 Identities = 15/63 (23%), Positives = 26/63 (41%) Frame = +2 Query: 131 GYDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGM 310 GY P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 1607 GYTPQSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSP 1666 Query: 311 VAP 319 +P Sbjct: 1667 TSP 1669 Score = 31.6 bits (70), Expect = 0.52 Identities = 15/62 (24%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ PN+ +P Sbjct: 1699 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPNYTPT 1758 Query: 314 AP 319 +P Sbjct: 1759 SP 1760 Score = 30.8 bits (68), Expect = 0.89 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 1615 YSPTSPSYSPTSPSYSPTSPNYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT 1674 Query: 314 AP 319 +P Sbjct: 1675 SP 1676 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 1692 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPNYSPT 1751 Query: 314 AP 319 +P Sbjct: 1752 SP 1753 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 1685 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT 1744 Query: 314 AP 319 +P Sbjct: 1745 SP 1746 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 1678 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT 1737 Query: 314 AP 319 +P Sbjct: 1738 SP 1739 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 1671 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT 1730 Query: 314 AP 319 +P Sbjct: 1731 SP 1732 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 1664 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT 1723 Query: 314 AP 319 +P Sbjct: 1724 SP 1725 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 1657 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT 1716 Query: 314 AP 319 +P Sbjct: 1717 SP 1718 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 1650 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT 1709 Query: 314 AP 319 +P Sbjct: 1710 SP 1711 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 1643 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT 1702 Query: 314 AP 319 +P Sbjct: 1703 SP 1704 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 1636 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT 1695 Query: 314 AP 319 +P Sbjct: 1696 SP 1697 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 1629 YSPTSPNYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT 1688 Query: 314 AP 319 +P Sbjct: 1689 SP 1690 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 1622 YSPTSPSYSPTSPNYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT 1681 Query: 314 AP 319 +P Sbjct: 1682 SP 1683 Score = 30.0 bits (66), Expect = 1.5 Identities = 14/63 (22%), Positives = 26/63 (41%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +P+Y P ++ P++ +P Sbjct: 1748 YSPTSPNYTPTSPSYSPTSPSYSPTSPNYTPTSPNYSPTSPSYSPTSPSYSPTSPSYSPS 1807 Query: 314 APR 322 +PR Sbjct: 1808 SPR 1810 Score = 29.6 bits (65), Expect = 2.0 Identities = 13/62 (20%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +P+Y P ++ P++ +P Sbjct: 1720 YSPTSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPNYTPTSPSYSPTSPSYSPTSPNYTPT 1779 Query: 314 AP 319 +P Sbjct: 1780 SP 1781 Score = 29.3 bits (64), Expect = 2.6 Identities = 15/62 (24%), Positives = 24/62 (38%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +PRY +P Y +PSY P ++ P + +P Sbjct: 1790 YSPTSPSYSPTSPSYSPSSPRYTPQSPTYTPSSPSYSPSSPSYSPTSPKYTPTSPSYSPS 1849 Query: 314 AP 319 +P Sbjct: 1850 SP 1851 Score = 29.3 bits (64), Expect = 2.6 Identities = 13/62 (20%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +P+Y P ++ P++ +P Sbjct: 1741 YSPTSPNYSPTSPNYTPTSPSYSPTSPSYSPTSPNYTPTSPNYSPTSPSYSPTSPSYSPT 1800 Query: 314 AP 319 +P Sbjct: 1801 SP 1802 Score = 28.9 bits (63), Expect = 3.4 Identities = 13/62 (20%), Positives = 24/62 (38%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +P+Y P + P++ +P Sbjct: 1713 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPNYTPTSPSYSPTSPSYSPT 1772 Query: 314 AP 319 +P Sbjct: 1773 SP 1774 Score = 28.5 bits (62), Expect = 4.4 Identities = 13/55 (23%), Positives = 24/55 (43%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAP 298 Y P Y + +P Y+ +PRY +P+Y P ++ P++ +P Sbjct: 1783 YSPTSPSYSPTSPSYSPTSPSYSPSSPRYTPQSPTYTPSSPSYSPSSPSYSPTSP 1837 Score = 27.3 bits (59), Expect = 9.9 Identities = 12/57 (21%), Positives = 22/57 (38%) Frame = +2 Query: 149 PGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMVAP 319 P Y + +P+Y +P Y +P Y P ++ P + +P +P Sbjct: 1823 PSYSPSSPSYSPTSPKYTPTSPSYSPSSPEYTPTSPKYSPTSPKYSPTSPKYSPTSP 1879
>RPB1_CAEBR (P35074) DNA-directed RNA polymerase II largest subunit (EC 2.7.7.6)| Length = 1853 Score = 32.0 bits (71), Expect = 0.40 Identities = 15/67 (22%), Positives = 28/67 (41%) Frame = +2 Query: 122 LTSGYDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPG 301 ++ Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 1612 VSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPS 1671 Query: 302 RGMVAPR 322 +PR Sbjct: 1672 YSPSSPR 1678 Score = 31.2 bits (69), Expect = 0.68 Identities = 15/63 (23%), Positives = 26/63 (41%) Frame = +2 Query: 131 GYDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGM 310 G V P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 1608 GQSPVSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSP 1667 Query: 311 VAP 319 +P Sbjct: 1668 TSP 1670 Score = 29.6 bits (65), Expect = 2.0 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +PRY +P+Y P ++ P + +P Sbjct: 1651 YSPTSPSYSPTSPSYSPTSPSYSPSSPRYSPTSPTYSPTSPTYSPTSPTYSPTSPTYSPT 1710 Query: 314 AP 319 +P Sbjct: 1711 SP 1712 Score = 28.9 bits (63), Expect = 3.4 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 1623 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPSSPRYSPT 1682 Query: 314 AP 319 +P Sbjct: 1683 SP 1684 Score = 28.5 bits (62), Expect = 4.4 Identities = 15/55 (27%), Positives = 25/55 (45%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAP 298 Y P YE G+ +P+Y+ +P Y +PSY P ++ P + +P Sbjct: 1707 YSPTSPSYE----GYSPSSPKYSPSSPTYSPTSPSYSPTSPQYSPTSPQYSPSSP 1757 Score = 28.5 bits (62), Expect = 4.4 Identities = 14/62 (22%), Positives = 24/62 (38%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P + +P Sbjct: 1630 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPSSPRYSPTSPTYSPT 1689 Query: 314 AP 319 +P Sbjct: 1690 SP 1691 Score = 27.7 bits (60), Expect = 7.5 Identities = 14/62 (22%), Positives = 24/62 (38%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P + +P Sbjct: 1637 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPSSPRYSPTSPTYSPTSPTYSPT 1696 Query: 314 AP 319 +P Sbjct: 1697 SP 1698
>RPB1_SCHPO (P36594) DNA-directed RNA polymerase II largest subunit (EC 2.7.7.6)| (RNA polymerase II subunit 1) Length = 1752 Score = 31.6 bits (70), Expect = 0.52 Identities = 15/67 (22%), Positives = 27/67 (40%) Frame = +2 Query: 119 ALTSGYDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAP 298 A + Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 1608 ATSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSP 1667 Query: 299 GRGMVAP 319 +P Sbjct: 1668 SYSPTSP 1674 Score = 31.2 bits (69), Expect = 0.68 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 1606 YSATSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT 1665 Query: 314 AP 319 +P Sbjct: 1666 SP 1667 Score = 31.2 bits (69), Expect = 0.68 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 1592 YSPTSPSYSPTSPSYSATSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT 1651 Query: 314 AP 319 +P Sbjct: 1652 SP 1653 Score = 31.2 bits (69), Expect = 0.68 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 1585 YSPTSPSYSPTSPSYSPTSPSYSATSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT 1644 Query: 314 AP 319 +P Sbjct: 1645 SP 1646 Score = 31.2 bits (69), Expect = 0.68 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 1578 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSATSPSYSPTSPSYSPTSPSYSPTSPSYSPT 1637 Query: 314 AP 319 +P Sbjct: 1638 SP 1639 Score = 30.8 bits (68), Expect = 0.89 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 1599 YSPTSPSYSATSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT 1658 Query: 314 AP 319 +P Sbjct: 1659 SP 1660 Score = 30.8 bits (68), Expect = 0.89 Identities = 13/57 (22%), Positives = 24/57 (42%) Frame = +2 Query: 149 PGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMVAP 319 P Y + +P Y+ +P Y +PSY P ++ P++ +P +P Sbjct: 1576 PSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSATSPSYSPTSPSYSPTSPSYSPTSP 1632 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 1690 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT 1749 Query: 314 AP 319 +P Sbjct: 1750 SP 1751 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 1683 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT 1742 Query: 314 AP 319 +P Sbjct: 1743 SP 1744 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 1676 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT 1735 Query: 314 AP 319 +P Sbjct: 1736 SP 1737 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 1669 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT 1728 Query: 314 AP 319 +P Sbjct: 1729 SP 1730 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 1662 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT 1721 Query: 314 AP 319 +P Sbjct: 1722 SP 1723 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 1655 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT 1714 Query: 314 AP 319 +P Sbjct: 1715 SP 1716 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 1648 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT 1707 Query: 314 AP 319 +P Sbjct: 1708 SP 1709 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 1641 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT 1700 Query: 314 AP 319 +P Sbjct: 1701 SP 1702 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 1634 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT 1693 Query: 314 AP 319 +P Sbjct: 1694 SP 1695 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 1627 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT 1686 Query: 314 AP 319 +P Sbjct: 1687 SP 1688 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 1620 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT 1679 Query: 314 AP 319 +P Sbjct: 1680 SP 1681 Score = 30.0 bits (66), Expect = 1.5 Identities = 17/80 (21%), Positives = 30/80 (37%), Gaps = 13/80 (16%) Frame = +2 Query: 119 ALTSGYDFVVPGYEMVLTGHGIM-------------APRYNIFAPRYDIFAPSYVVVCPG 259 A++ GY P Y G+ +P Y+ +P Y +PSY P Sbjct: 1546 AMSPGYGLTSPSYSPSSPGYSTSPAYMPSSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPS 1605 Query: 260 HNVVFPNHDMVAPGRGMVAP 319 ++ P++ +P +P Sbjct: 1606 YSATSPSYSPTSPSYSPTSP 1625
>RPB1_ASHGO (Q75A34) DNA-directed RNA polymerase II largest subunit (EC 2.7.7.6)| (RNA polymerase II subunit 1) Length = 1745 Score = 31.2 bits (69), Expect = 0.68 Identities = 14/63 (22%), Positives = 26/63 (41%) Frame = +2 Query: 131 GYDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGM 310 G+ P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 1544 GFSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSP 1603 Query: 311 VAP 319 +P Sbjct: 1604 TSP 1606 Score = 31.2 bits (69), Expect = 0.68 Identities = 14/61 (22%), Positives = 26/61 (42%) Frame = +2 Query: 137 DFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMVA 316 D PG+ + +P Y+ +P Y +PSY P ++ P++ +P + Sbjct: 1539 DVSSPGFSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTS 1598 Query: 317 P 319 P Sbjct: 1599 P 1599 Score = 30.8 bits (68), Expect = 0.89 Identities = 14/63 (22%), Positives = 26/63 (41%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 1657 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT 1716 Query: 314 APR 322 +P+ Sbjct: 1717 SPQ 1719 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 1650 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT 1709 Query: 314 AP 319 +P Sbjct: 1710 SP 1711 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 1643 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT 1702 Query: 314 AP 319 +P Sbjct: 1703 SP 1704 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 1636 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT 1695 Query: 314 AP 319 +P Sbjct: 1696 SP 1697 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 1629 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT 1688 Query: 314 AP 319 +P Sbjct: 1689 SP 1690 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 1622 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT 1681 Query: 314 AP 319 +P Sbjct: 1682 SP 1683 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 1615 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT 1674 Query: 314 AP 319 +P Sbjct: 1675 SP 1676 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 1608 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT 1667 Query: 314 AP 319 +P Sbjct: 1668 SP 1669 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 1601 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT 1660 Query: 314 AP 319 +P Sbjct: 1661 SP 1662 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 1594 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT 1653 Query: 314 AP 319 +P Sbjct: 1654 SP 1655 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 1587 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT 1646 Query: 314 AP 319 +P Sbjct: 1647 SP 1648 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 1580 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT 1639 Query: 314 AP 319 +P Sbjct: 1640 SP 1641 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 1573 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT 1632 Query: 314 AP 319 +P Sbjct: 1633 SP 1634 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 1566 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT 1625 Query: 314 AP 319 +P Sbjct: 1626 SP 1627 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 1559 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT 1618 Query: 314 AP 319 +P Sbjct: 1619 SP 1620 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 1552 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT 1611 Query: 314 AP 319 +P Sbjct: 1612 SP 1613 Score = 27.3 bits (59), Expect = 9.9 Identities = 13/55 (23%), Positives = 22/55 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAP 298 Y P Y + +P Y+ +P Y +PSY P ++ P + +P Sbjct: 1671 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPQYSPRSP 1725
>THIG_WIGBR (Q8D249) Thiazole biosynthesis protein thiG| Length = 254 Score = 30.8 bits (68), Expect = 0.89 Identities = 16/41 (39%), Positives = 22/41 (53%) Frame = +3 Query: 150 PVTKWFLPDTVLWLPDTTFLLPDTIFLLPPTSLCVPDTMLC 272 P TK+ LPD+V L L+ D +LP C PD ++C Sbjct: 100 PETKYLLPDSVETLIAAKILVKDGFVVLP---YCFPDPVIC 137
>YHGE_BACSU (P32399) Hypothetical protein yhgE (ORFB)| Length = 775 Score = 30.8 bits (68), Expect = 0.89 Identities = 16/48 (33%), Positives = 23/48 (47%) Frame = -1 Query: 277 GKHNIVSGTHNDVGGSKNIVSGSKNVVSGSHNTVSGKNHFVTGHNKVV 134 G +V+G+ GG ++ GSK V SGS G TG K++ Sbjct: 485 GSEQLVTGSSQVSGGLFKLLDGSKQVQSGSSKLADGSASLDTGLGKLL 532 Score = 30.8 bits (68), Expect = 0.89 Identities = 16/53 (30%), Positives = 25/53 (47%) Frame = -1 Query: 307 AASGSYHVVIGKHNIVSGTHNDVGGSKNIVSGSKNVVSGSHNTVSGKNHFVTG 149 A +GS +V G + G + GSK + SGS + GS + +G + G Sbjct: 482 AKAGSEQLVTGSSQVSGGLFKLLDGSKQVQSGSSKLADGSASLDTGLGKLLDG 534
>RPB1_CAEEL (P16356) DNA-directed RNA polymerase II largest subunit (EC 2.7.7.6)| Length = 1852 Score = 30.4 bits (67), Expect = 1.2 Identities = 15/67 (22%), Positives = 28/67 (41%) Frame = +2 Query: 122 LTSGYDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPG 301 ++ Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 1608 VSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPSSPSYSPSSPS 1667 Query: 302 RGMVAPR 322 +PR Sbjct: 1668 YSPSSPR 1674 Score = 30.0 bits (66), Expect = 1.5 Identities = 15/64 (23%), Positives = 27/64 (42%) Frame = +2 Query: 128 SGYDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRG 307 +G V P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 1603 AGQSPVSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPSSPSYS 1662 Query: 308 MVAP 319 +P Sbjct: 1663 PSSP 1666 Score = 28.9 bits (63), Expect = 3.4 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +PRY +P+Y P ++ P + +P Sbjct: 1647 YSPTSPSYSPSSPSYSPSSPSYSPSSPRYSPTSPTYSPTSPTYSPTSPTYSPTSPTYSPT 1706 Query: 314 AP 319 +P Sbjct: 1707 SP 1708 Score = 27.7 bits (60), Expect = 7.5 Identities = 14/62 (22%), Positives = 24/62 (38%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P + +P Sbjct: 1633 YSPTSPSYSPTSPSYSPTSPSYSPSSPSYSPSSPSYSPSSPRYSPTSPTYSPTSPTYSPT 1692 Query: 314 AP 319 +P Sbjct: 1693 SP 1694 Score = 27.7 bits (60), Expect = 7.5 Identities = 14/62 (22%), Positives = 24/62 (38%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P + +P Sbjct: 1626 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPSSPSYSPSSPSYSPSSPRYSPTSPTYSPT 1685 Query: 314 AP 319 +P Sbjct: 1686 SP 1687 Score = 27.3 bits (59), Expect = 9.9 Identities = 15/55 (27%), Positives = 25/55 (45%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAP 298 Y P YE G+ +P+Y+ +P Y +PSY P ++ P + +P Sbjct: 1703 YSPTSPSYESG-GGYSPSSPKYSPSSPTYSPTSPSYSPTSPQYSPTSPQYSPSSP 1756 Score = 27.3 bits (59), Expect = 9.9 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 1619 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPSSPSYSPSSPSYSPSSPRYSPT 1678 Query: 314 AP 319 +P Sbjct: 1679 SP 1680
>RPB1_DICDI (P35084) DNA-directed RNA polymerase II largest subunit (EC| 2.7.7.6) (Fragment) Length = 902 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 798 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT 857 Query: 314 AP 319 +P Sbjct: 858 SP 859 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 791 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT 850 Query: 314 AP 319 +P Sbjct: 851 SP 852 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 784 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT 843 Query: 314 AP 319 +P Sbjct: 844 SP 845 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 777 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT 836 Query: 314 AP 319 +P Sbjct: 837 SP 838 Score = 29.6 bits (65), Expect = 2.0 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 805 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPS 864 Query: 314 AP 319 +P Sbjct: 865 SP 866 Score = 29.6 bits (65), Expect = 2.0 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 756 YSPTSPSYSPTSPSYSPTSPFYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT 815 Query: 314 AP 319 +P Sbjct: 816 SP 817 Score = 29.6 bits (65), Expect = 2.0 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 749 YSPTSPSYSPTSPSYSPTSPSYSPTSPFYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT 808 Query: 314 AP 319 +P Sbjct: 809 SP 810 Score = 29.3 bits (64), Expect = 2.6 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 770 YSPTSPFYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT 829 Query: 314 AP 319 +P Sbjct: 830 SP 831 Score = 29.3 bits (64), Expect = 2.6 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 763 YSPTSPSYSPTSPFYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT 822 Query: 314 AP 319 +P Sbjct: 823 SP 824 Score = 29.3 bits (64), Expect = 2.6 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 735 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPFYSPTSPSYSPTSPSYSPT 794 Query: 314 AP 319 +P Sbjct: 795 SP 796 Score = 28.9 bits (63), Expect = 3.4 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 812 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPSSPSYSPS 871 Query: 314 AP 319 +P Sbjct: 872 SP 873 Score = 28.9 bits (63), Expect = 3.4 Identities = 14/62 (22%), Positives = 24/62 (38%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P + +P Sbjct: 728 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPFYSPTSPSYSPT 787 Query: 314 AP 319 +P Sbjct: 788 SP 789 Score = 28.1 bits (61), Expect = 5.8 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 819 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPSSPSYSPSSPSYSPS 878 Query: 314 AP 319 +P Sbjct: 879 SP 880 Score = 28.1 bits (61), Expect = 5.8 Identities = 13/62 (20%), Positives = 24/62 (38%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +P Y P ++ P++ +P Sbjct: 742 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPFYSPTSPSYSPTSPSYSPTSPSYSPT 801 Query: 314 AP 319 +P Sbjct: 802 SP 803 Score = 28.1 bits (61), Expect = 5.8 Identities = 13/57 (22%), Positives = 24/57 (42%) Frame = +2 Query: 149 PGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMVAP 319 P Y + +P Y+ +P Y +PSY P ++ P++ +P +P Sbjct: 726 PTYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPFYSPTSP 782 Score = 27.3 bits (59), Expect = 9.9 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 826 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPSSPSYSPSSPSYSPSSPSYSPS 885 Query: 314 AP 319 +P Sbjct: 886 SP 887 Score = 27.3 bits (59), Expect = 9.9 Identities = 11/44 (25%), Positives = 21/44 (47%) Frame = +2 Query: 188 APRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMVAP 319 +P Y+ +P Y +PSY P ++ P++ +P +P Sbjct: 725 SPTYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSP 768
>RPB1_ENCCU (Q8SSC4) DNA-directed RNA polymerase II largest subunit (EC 2.7.7.6)| (RNA polymerase II subunit 1) Length = 1599 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 1508 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT 1567 Query: 314 AP 319 +P Sbjct: 1568 SP 1569 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 1501 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT 1560 Query: 314 AP 319 +P Sbjct: 1561 SP 1562 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 1494 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT 1553 Query: 314 AP 319 +P Sbjct: 1554 SP 1555 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 1487 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT 1546 Query: 314 AP 319 +P Sbjct: 1547 SP 1548 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 1480 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT 1539 Query: 314 AP 319 +P Sbjct: 1540 SP 1541 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/62 (22%), Positives = 25/62 (40%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 Y P Y + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 1473 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT 1532 Query: 314 AP 319 +P Sbjct: 1533 SP 1534 Score = 30.0 bits (66), Expect = 1.5 Identities = 13/57 (22%), Positives = 24/57 (42%) Frame = +2 Query: 149 PGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMVAP 319 P Y + +P Y+ +P Y +PSY P ++ P++ +P +P Sbjct: 1471 PSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSP 1527 Score = 27.3 bits (59), Expect = 9.9 Identities = 11/44 (25%), Positives = 21/44 (47%) Frame = +2 Query: 188 APRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMVAP 319 +P Y+ +P Y +PSY P ++ P++ +P +P Sbjct: 1470 SPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSP 1513
>RPB1_DROME (P04052) DNA-directed RNA polymerase II largest subunit (EC 2.7.7.6)| Length = 1887 Score = 30.0 bits (66), Expect = 1.5 Identities = 15/58 (25%), Positives = 25/58 (43%) Frame = +2 Query: 125 TSGYDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAP 298 +S Y P Y + +P Y+ +P Y +PSY P + V P++ +P Sbjct: 1675 SSNYSPNSPSYSPTSPSYSPSSPSYSPTSPCYSPTSPSYSPTSPNYTPVTPSYSPTSP 1732 Score = 28.5 bits (62), Expect = 4.4 Identities = 17/66 (25%), Positives = 29/66 (43%), Gaps = 2/66 (3%) Frame = +2 Query: 128 SGYDFVVPG--YEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPG 301 SG + PG Y + + +P Y+ +P Y +PSY P ++ P++ +P Sbjct: 1660 SGSNIYSPGNAYSPSSSNYSPNSPSYSPTSPSYSPSSPSYSPTSPCYSPTSPSYSPTSPN 1719 Query: 302 RGMVAP 319 V P Sbjct: 1720 YTPVTP 1725 Score = 28.1 bits (61), Expect = 5.8 Identities = 12/44 (27%), Positives = 20/44 (45%) Frame = +2 Query: 188 APRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMVAP 319 +P Y+ +P Y +P Y P ++ PN+ V P +P Sbjct: 1689 SPSYSPSSPSYSPTSPCYSPTSPSYSPTSPNYTPVTPSYSPTSP 1732 Score = 28.1 bits (61), Expect = 5.8 Identities = 13/50 (26%), Positives = 22/50 (44%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNH 283 Y P Y + +P Y+ +P Y +P+Y V P ++ PN+ Sbjct: 1685 YSPTSPSYSPSSPSYSPTSPCYSPTSPSYSPTSPNYTPVTPSYSPTSPNY 1734
>KCMA1_CANFA (Q28265) Calcium-activated potassium channel alpha subunit 1| (Calcium-activated potassium channel, subfamily M, alpha subunit 1) (Maxi K channel) (MaxiK) (BK channel) (K(VCA)alpha) (BKCA alpha) (KCa1.1) (Slowpoke homolog) (Slo homolog) (Slo-a Length = 1159 Score = 29.6 bits (65), Expect = 2.0 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = -1 Query: 262 VSGTHNDVGGSKNIVSGSKNVVSGSHNTVSGKNHFV 155 + G GGS + VSG K++V H T+ +HF+ Sbjct: 328 IIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSHFL 363
>GBLP_SCHPO (Q10281) Guanine nucleotide-binding protein beta subunit-like| protein (Receptor of activated protein kinase C) Length = 314 Score = 29.6 bits (65), Expect = 2.0 Identities = 27/92 (29%), Positives = 42/92 (45%), Gaps = 7/92 (7%) Frame = -1 Query: 316 SNHAASGSYHVVIGKHNIVSG--THNDVGGSKNIVSGS-----KNVVSGSHNTVSGKNHF 158 S++A S S+ I ++ G TH VG + +++S S + VVSGS + + Sbjct: 75 SHYALSASWDKTIRLWDLEKGECTHQFVGHTSDVLSVSISPDNRQVVSGSRDKTIKIWNI 134 Query: 157 VTGHNKVVT*G*CPCTSWYKCVRCSIRPFTLT 62 + +T G + W CVR S P LT Sbjct: 135 IGNCKYTITDG--GHSDWVSCVRFSPNPDNLT 164
>CDSN_MOUSE (Q7TPC1) Corneodesmosin precursor| Length = 561 Score = 29.3 bits (64), Expect = 2.6 Identities = 18/52 (34%), Positives = 24/52 (46%) Frame = -1 Query: 322 SGSNHAASGSYHVVIGKHNIVSGTHNDVGGSKNIVSGSKNVVSGSHNTVSGK 167 +GS+ + SGS G SG+ GS SGS SGS + SG+ Sbjct: 136 TGSSSSQSGSSGSQSGSSGSQSGSSGSQSGSSGSQSGSSGSQSGSSGSQSGR 187 Score = 28.5 bits (62), Expect = 4.4 Identities = 18/58 (31%), Positives = 26/58 (44%) Frame = -1 Query: 322 SGSNHAASGSYHVVIGKHNIVSGTHNDVGGSKNIVSGSKNVVSGSHNTVSGKNHFVTG 149 +GS+ + +GS G SG+ GS SGS SGS + SG + +G Sbjct: 129 TGSSSSQTGSSSSQSGSSGSQSGSSGSQSGSSGSQSGSSGSQSGSSGSQSGSSGSQSG 186
>PRTG_ERWCH (Q07162) Secreted protease G precursor (EC 3.4.24.-) (ProG)| Length = 475 Score = 29.3 bits (64), Expect = 2.6 Identities = 18/56 (32%), Positives = 28/56 (50%) Frame = -1 Query: 322 SGSNHAASGSYHVVIGKHNIVSGTHNDVGGSKNIVSGSKNVVSGSHNTVSGKNHFV 155 +G N S + + +++SGT +DVGG K +VS + V N + G H V Sbjct: 294 AGGNDTFDFSGYSANQRISLISGTFSDVGGLKAMVSIAAGAV--IENAIGGSGHDV 347
>MGA_HUMAN (O43451) Maltase-glucoamylase, intestinal [Includes: Maltase (EC| 3.2.1.20) (Alpha-glucosidase); Glucoamylase (EC 3.2.1.3) (Glucan 1,4-alpha-glucosidase)] Length = 1856 Score = 28.9 bits (63), Expect = 3.4 Identities = 21/81 (25%), Positives = 33/81 (40%), Gaps = 5/81 (6%) Frame = +3 Query: 63 VNVKGRMLQRTH-----LYHDVHGH*PQVTTLLCPVTKWFLPDTVLWLPDTTFLLPDTIF 227 VN+ +LQ + LY +H + T++ P+ F+ D V W D+ FLL Sbjct: 1601 VNISRTVLQTRYTLLPYLYTLMHKAHTEGVTVVRPLLHEFVSDQVTWDIDSQFLLGPAFL 1660 Query: 228 LLPPTSLCVPDTMLCFPITTW 290 + P + FP W Sbjct: 1661 VSPVLERNARNVTAYFPRARW 1681
>PLS_STAAN (P61598) Putative surface protein SA2285 precursor| Length = 1370 Score = 28.5 bits (62), Expect = 4.4 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = -1 Query: 235 GSKNIVSGSKNVVSGSHNTVSGKNHF 158 GS +I SKNVV + T+ GK HF Sbjct: 149 GSFDITRDSKNVVESTPITIQGKEHF 174
>PLS_STAAW (Q8NUV0) Putative surface protein MW2416 precursor| Length = 1371 Score = 28.5 bits (62), Expect = 4.4 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = -1 Query: 235 GSKNIVSGSKNVVSGSHNTVSGKNHF 158 GS +I SKNVV + T+ GK HF Sbjct: 149 GSFDITRDSKNVVESTPITIQGKEHF 174
>PLS_STAAM (Q931E9) Putative surface protein SAV2496/SAV2497 precursor| Length = 1114 Score = 28.5 bits (62), Expect = 4.4 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = -1 Query: 235 GSKNIVSGSKNVVSGSHNTVSGKNHF 158 GS +I SKNVV + T+ GK HF Sbjct: 149 GSFDITRDSKNVVESTPITIQGKEHF 174
>DUT_CANGA (Q6FKQ6) Deoxyuridine 5'-triphosphate nucleotidohydrolase (EC| 3.6.1.23) (dUTPase) (dUTP pyrophosphatase) Length = 144 Score = 28.5 bits (62), Expect = 4.4 Identities = 17/52 (32%), Positives = 27/52 (51%), Gaps = 3/52 (5%) Frame = +2 Query: 176 HGIMAPRYNIFAPRYDIFAPS-YVVVCPGHNVVFPNHDMVAP--GRGMVAPR 322 HGI + +++A YDI+A + YV+ G +V + P G +APR Sbjct: 14 HGIAPTKGSVYAAGYDIYASADYVIPAMGQGMVPTDISFTVPEGTYGRIAPR 65
>PAAK_ECOLI (P76085) Phenylacetate-coenzyme A ligase (EC 6.2.1.30)| (Phenylacetyl-CoA ligase) (PA-CoA ligase) Length = 437 Score = 28.1 bits (61), Expect = 5.8 Identities = 16/41 (39%), Positives = 21/41 (51%) Frame = -1 Query: 310 HAASGSYHVVIGKHNIVSGTHNDVGGSKNIVSGSKNVVSGS 188 HA+SG+ GK +V T ND+ NIV+ S GS Sbjct: 91 HASSGT----TGKPTVVGYTQNDIDNWANIVARSLRAAGGS 127
>P200_MYCGE (Q49429) Protein P200| Length = 1616 Score = 28.1 bits (61), Expect = 5.8 Identities = 17/62 (27%), Positives = 24/62 (38%) Frame = +2 Query: 134 YDFVVPGYEMVLTGHGIMAPRYNIFAPRYDIFAPSYVVVCPGHNVVFPNHDMVAPGRGMV 313 YDF P Y+ L P+Y++ P YD P+Y + F PG + Sbjct: 1270 YDFDQPSYDSDLQPS---EPQYDVDEPNYDFDEPNYEIESKPSEPQFEPQVEQQPGEAVF 1326 Query: 314 AP 319 P Sbjct: 1327 EP 1328
>GRP9_DAUCA (P37703) Glycine-rich protein DC9.1| Length = 144 Score = 28.1 bits (61), Expect = 5.8 Identities = 18/59 (30%), Positives = 25/59 (42%) Frame = -1 Query: 319 GSNHAASGSYHVVIGKHNIVSGTHNDVGGSKNIVSGSKNVVSGSHNTVSGKNHFVTGHN 143 G + G YH G +N G HN GG N G + G +N G ++ G+N Sbjct: 48 GGGYNNGGGYHNGGGGYNNGGGYHNGGGGYNN--GGGYHNGGGGYNNGGGHHNGGGGYN 104
>GRP1_CHERU (P11898) Glycine-rich protein HC1| Length = 144 Score = 28.1 bits (61), Expect = 5.8 Identities = 18/59 (30%), Positives = 25/59 (42%) Frame = -1 Query: 319 GSNHAASGSYHVVIGKHNIVSGTHNDVGGSKNIVSGSKNVVSGSHNTVSGKNHFVTGHN 143 G + G YH G +N G HN GG N G + G +N G ++ G+N Sbjct: 48 GGGYNNGGGYHNGGGGYNNGGGYHNGGGGYNN--GGGYHNGGGGYNNGGGHHNGGGGYN 104
>MNB_DROME (P49657) Serine/threonine-protein kinase minibrain (EC 2.7.12.1)| Length = 908 Score = 27.7 bits (60), Expect = 7.5 Identities = 17/59 (28%), Positives = 31/59 (52%), Gaps = 1/59 (1%) Frame = -1 Query: 322 SGSNHAASGSYHV-VIGKHNIVSGTHNDVGGSKNIVSGSKNVVSGSHNTVSGKNHFVTG 149 SGS SG V V+G+ ++G VG S+++ SGS +G+ ++ + + + G Sbjct: 839 SGSASVGSGGVGVGVVGQRRHITGPAAQVGISQSVGSGSSGSATGASSSDASSSSPMVG 897
>GRPA_MEDFA (Q09134) Abscisic acid and environmental stress-inducible protein| Length = 159 Score = 27.3 bits (59), Expect = 9.9 Identities = 19/60 (31%), Positives = 25/60 (41%), Gaps = 1/60 (1%) Frame = -1 Query: 319 GSNHAASGSYHVVIGKHNIVSGTHNDVGGSKNIVSGSKNVVSGSHNT-VSGKNHFVTGHN 143 G + G Y+ G +N G +N GG N G N G +N G NH G+N Sbjct: 57 GGGYNNGGGYNHGGGGYNNGGGGYNHGGGGYNNGGGGYNHGGGGYNNGGGGYNHGGGGYN 116
>GOGA6_HUMAN (Q9NYA3) Golgin subfamily A member 6 (Golgin linked to PML)| (Golgin-like protein) Length = 693 Score = 27.3 bits (59), Expect = 9.9 Identities = 16/63 (25%), Positives = 34/63 (53%) Frame = -3 Query: 317 EQPCRVRELPCRDWETQHCVRDTQRRRREQKYRIWEQKCCIWEP*YRVR*EPFRNRAQQS 138 EQ R+R+ R + + +R + R ++Q+ R+W+Q+ +W+ R++ + R Q+ Sbjct: 376 EQGERLRKQEQRLRKQEERLRKEEERLQKQEKRLWDQEERLWKKEERLQKQEERLALSQN 435 Query: 137 RNL 129 L Sbjct: 436 HKL 438
>SUIS_RAT (P23739) Sucrase-isomaltase, intestinal [Contains: Sucrase (EC| 3.2.1.48); Isomaltase (EC 3.2.1.10)] Length = 1840 Score = 27.3 bits (59), Expect = 9.9 Identities = 15/51 (29%), Positives = 20/51 (39%) Frame = +3 Query: 138 TLLCPVTKWFLPDTVLWLPDTTFLLPDTIFLLPPTSLCVPDTMLCFPITTW 290 T+ P F DT W+ DT FL + + P V + P TW Sbjct: 717 TVARPFLYEFYDDTNSWIEDTQFLWGPALLITPVLRPGVENVSAYIPNATW 767 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 53,587,145 Number of Sequences: 219361 Number of extensions: 1133772 Number of successful extensions: 3614 Number of sequences better than 10.0: 32 Number of HSP's better than 10.0 without gapping: 3094 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3523 length of database: 80,573,946 effective HSP length: 82 effective length of database: 62,586,344 effective search space used: 1502072256 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
