| Clone Name | rbart23e02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | DRI_DROME (Q24573) Protein dead ringer (Protein retained) | 32 | 0.38 | 2 | THA11_HUMAN (Q96EK4) THAP domain-containing protein 11 | 28 | 4.2 | 3 | THA11_MOUSE (Q9JJD0) THAP domain-containing protein 11 | 28 | 4.2 | 4 | BXD_CLOBO (P19321) Botulinum neurotoxin type D precursor (EC 3.4... | 28 | 5.5 | 5 | FRQ_CRESP (Q00586) Frequency clock protein | 27 | 9.3 |
|---|
>DRI_DROME (Q24573) Protein dead ringer (Protein retained)| Length = 911 Score = 32.0 bits (71), Expect = 0.38 Identities = 17/48 (35%), Positives = 26/48 (54%) Frame = +2 Query: 5 GKMGGTKFFFISPSTGKNNRKGTT*HLAVHTTSRSITKYEASKAKQCN 148 G +GG +F F SP+ + ++ H A ++ S S T EAS + Q N Sbjct: 227 GGVGGHQFSFASPTAAPSGKEAR--HFAANSASNSSTSSEASNSSQQN 272
>THA11_HUMAN (Q96EK4) THAP domain-containing protein 11| Length = 313 Score = 28.5 bits (62), Expect = 4.2 Identities = 21/56 (37%), Positives = 28/56 (50%), Gaps = 5/56 (8%) Frame = -2 Query: 178 IWIKSVGRWGVALFCF*RLVFCDGPA-CSVN----R*VLCSSFPVVFPCRGRNEKK 26 +W+K+V R GV+ CF G CSV+ R P +FP RG NE+K Sbjct: 35 LWLKNVSRAGVS-GCFSTFQPTTGHRLCSVHFQGGRKTYTVRVPTIFPLRGVNERK 89
>THA11_MOUSE (Q9JJD0) THAP domain-containing protein 11| Length = 305 Score = 28.5 bits (62), Expect = 4.2 Identities = 21/56 (37%), Positives = 28/56 (50%), Gaps = 5/56 (8%) Frame = -2 Query: 178 IWIKSVGRWGVALFCF*RLVFCDGPA-CSVN----R*VLCSSFPVVFPCRGRNEKK 26 +W+K+V R GV+ CF G CSV+ R P +FP RG NE+K Sbjct: 35 LWLKNVSRAGVS-GCFSTFQPTTGHRLCSVHFQGGRKTYTVRVPTIFPLRGVNERK 89
>BXD_CLOBO (P19321) Botulinum neurotoxin type D precursor (EC 3.4.24.69)| (BoNT/D) (Bontoxilysin D) [Contains: Botulinum neurotoxin D light chain; Botulinum neurotoxin D heavy chain] Length = 1276 Score = 28.1 bits (61), Expect = 5.5 Identities = 18/51 (35%), Positives = 24/51 (47%), Gaps = 2/51 (3%) Frame = +2 Query: 38 SPSTGKNNRKGTT*HLAVHTTSRSITKYEASKAKQCN--TPSTDRFNPNPN 184 SP G ++ T HTT+ ++ K+E K N TPS F P PN Sbjct: 114 SPFMGDSSTPEDTFDFTRHTTNIAVEKFENGSWKVTNIITPSVLIFGPLPN 164
>FRQ_CRESP (Q00586) Frequency clock protein| Length = 1015 Score = 27.3 bits (59), Expect = 9.3 Identities = 13/57 (22%), Positives = 28/57 (49%) Frame = +1 Query: 49 REKQPERNYITLSGSHYKQVHHKIRGVKSKTMQHPIDRPI*SKSKQTHDMATGPTTN 219 +++QP+ N+IT G+ + V +R + +H K + +HD+ + +N Sbjct: 365 QQQQPKSNFITNPGATFSSVPEPLREARILPQEHQYGHVAGQKGR-SHDIGSASNSN 420 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45,412,148 Number of Sequences: 219361 Number of extensions: 754025 Number of successful extensions: 1794 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1777 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1794 length of database: 80,573,946 effective HSP length: 98 effective length of database: 59,076,568 effective search space used: 1417837632 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)