Clone Name | rbart23e01 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | PLSX_PROMA (Q7VE56) Fatty acid/phospholipid synthesis protein plsX | 31 | 1.4 | 2 | SGCX_ECOLI (P39366) Putative sgc region protein sgcX | 28 | 9.4 | 3 | LAMA5_HUMAN (O15230) Laminin alpha-5 chain precursor | 28 | 9.4 |
---|
>PLSX_PROMA (Q7VE56) Fatty acid/phospholipid synthesis protein plsX| Length = 436 Score = 31.2 bits (69), Expect = 1.4 Identities = 13/42 (30%), Positives = 23/42 (54%), Gaps = 3/42 (7%) Frame = +1 Query: 91 RNEVIDAKNVWIS---SGGTQAPGECRDGCMLGLQLFTPSIK 207 RN++ ++K +W++ GG APG +GC+ + IK Sbjct: 88 RNDIANSKRLWVAVDGMGGDNAPGSILEGCLQAIDRLPLCIK 129
>SGCX_ECOLI (P39366) Putative sgc region protein sgcX| Length = 373 Score = 28.5 bits (62), Expect = 9.4 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = +1 Query: 31 PVPSIGASCRYTHSDHFVASRNEVIDAKNVWISSGGTQA 147 P S+ CRYTHS VAS ++ D + + G A Sbjct: 317 PCASLSIPCRYTHSPAEVASLRDLTDCIRLLTALAGMSA 355
>LAMA5_HUMAN (O15230) Laminin alpha-5 chain precursor| Length = 3695 Score = 28.5 bits (62), Expect = 9.4 Identities = 20/68 (29%), Positives = 24/68 (35%) Frame = +1 Query: 166 GCMLGLQLFTPSIKPRDRYLCTVY***HLRPPSMAMAGRRSIHPAIHPSHRIPPXXXXXX 345 GC LQ TP + PR + A RRS PA HP+ +PP Sbjct: 3291 GCAPALQAQTPGLGPRGLQA------------TARKASRRSRQPARHPACMLPPHLRTTR 3338 Query: 346 XXXXXXGS 369 GS Sbjct: 3339 DSYQFGGS 3346 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 70,229,442 Number of Sequences: 219361 Number of extensions: 1352222 Number of successful extensions: 2945 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2868 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2944 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3188886965 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)