| Clone Name | rbart23d08 |
|---|---|
| Clone Library Name | barley_pub |
>PIP13_ORYSA (Q9SXF8) Aquaporin PIP 1.3 (Plasma membrane intrinsic protein 1.3)| (OsPIP1.3) (Water channel protein RWC3) (RWC-3) Length = 288 Score = 52.4 bits (124), Expect = 5e-07 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -2 Query: 434 GPFIGAALAAIYHVVVIRAIPFKSR 360 GPFIGAALAAIYHVVVIRAIPFKSR Sbjct: 263 GPFIGAALAAIYHVVVIRAIPFKSR 287
>PIP11_VICFA (P61838) Aquaporin PIP1.1 (Plasma membrane intrinsic protein 1a)| (PIP1a) (Aquaporin 1) (Plasma membrane aquaporin 1) Length = 286 Score = 51.6 bits (122), Expect = 8e-07 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = -2 Query: 434 GPFIGAALAAIYHVVVIRAIPFKSR 360 GPFIGAALAA+YHVVVIRAIPFKSR Sbjct: 261 GPFIGAALAALYHVVVIRAIPFKSR 285
>PIP11_ARATH (P61837) Aquaporin PIP1.1 (Plasma membrane intrinsic protein 1a)| (PIP1a) (Aquaporin 1) (Plasma membrane aquaporin 1) Length = 286 Score = 51.6 bits (122), Expect = 8e-07 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = -2 Query: 434 GPFIGAALAAIYHVVVIRAIPFKSR 360 GPFIGAALAA+YHVVVIRAIPFKSR Sbjct: 261 GPFIGAALAALYHVVVIRAIPFKSR 285
>PIP12_ARATH (Q06611) Aquaporin PIP1.2 (Plasma membrane intrinsic protein 1b)| (PIP1b) (Transmembrane protein A) (TMP-A) (AthH2) Length = 286 Score = 51.2 bits (121), Expect = 1e-06 Identities = 23/25 (92%), Positives = 25/25 (100%) Frame = -2 Query: 434 GPFIGAALAAIYHVVVIRAIPFKSR 360 GPFIGAALAA+YHV+VIRAIPFKSR Sbjct: 261 GPFIGAALAALYHVIVIRAIPFKSR 285
>PIP12_ORYSA (Q7XSQ9) Probable aquaporin PIP1.2 (Plasma membrane intrinsic| protein 1.2) (OsPIP1.2) Length = 282 Score = 50.1 bits (118), Expect = 2e-06 Identities = 24/25 (96%), Positives = 24/25 (96%) Frame = -2 Query: 434 GPFIGAALAAIYHVVVIRAIPFKSR 360 GPFIGAALAAIYH VVIRAIPFKSR Sbjct: 257 GPFIGAALAAIYHQVVIRAIPFKSR 281
>PIP11_ORYSA (Q6EU94) Aquaporin PIP1.1 (Plasma membrane intrinsic protein 1a)| (PIP1a) (OsPIP1.1) (Water channel protein RWC1) (RWC-1) Length = 289 Score = 49.3 bits (116), Expect = 4e-06 Identities = 22/25 (88%), Positives = 24/25 (96%) Frame = -2 Query: 434 GPFIGAALAAIYHVVVIRAIPFKSR 360 GPF+GAALAAIYH V+IRAIPFKSR Sbjct: 264 GPFVGAALAAIYHQVIIRAIPFKSR 288
>PIP13_ARATH (Q08733) Aquaporin PIP1.3 (Plasma membrane intrinsic protein 1c)| (PIP1c) (Transmembrane protein B) (TMP-B) Length = 286 Score = 48.1 bits (113), Expect = 9e-06 Identities = 22/25 (88%), Positives = 24/25 (96%) Frame = -2 Query: 434 GPFIGAALAAIYHVVVIRAIPFKSR 360 GPFIGAALAA+YH +VIRAIPFKSR Sbjct: 261 GPFIGAALAALYHQLVIRAIPFKSR 285
>PIP2_PEA (P25794) Probable aquaporin PIP-type 7a (Turgor-responsive protein| 7a) (Turgor-responsive protein 31) Length = 289 Score = 48.1 bits (113), Expect = 9e-06 Identities = 22/25 (88%), Positives = 24/25 (96%) Frame = -2 Query: 434 GPFIGAALAAIYHVVVIRAIPFKSR 360 GPFIGAALAA+YH VVIRAIPFKS+ Sbjct: 265 GPFIGAALAALYHQVVIRAIPFKSK 289
>PIP15_ARATH (Q8LAA6) Probable aquaporin PIP1.5 (Plasma membrane intrinsic| protein 1d) (PIP1d) Length = 287 Score = 47.8 bits (112), Expect = 1e-05 Identities = 21/25 (84%), Positives = 24/25 (96%) Frame = -2 Query: 434 GPFIGAALAAIYHVVVIRAIPFKSR 360 GPFIGAALAA+YH +VIRAIPFKS+ Sbjct: 262 GPFIGAALAALYHQIVIRAIPFKSK 286
>PIP14_ARATH (Q39196) Probable aquaporin PIP1.4 (Plasma membrane intrinsic| protein 1.4) (Transmembrane protein C) (TMP-C) Length = 287 Score = 47.8 bits (112), Expect = 1e-05 Identities = 21/25 (84%), Positives = 24/25 (96%) Frame = -2 Query: 434 GPFIGAALAAIYHVVVIRAIPFKSR 360 GPFIGAALAA+YH +VIRAIPFKS+ Sbjct: 262 GPFIGAALAALYHQIVIRAIPFKSK 286
>PIP1_LYCES (Q08451) Probable aquaporin PIP-type pTOM75 (Ripening-associated| membrane protein) (RAMP) Length = 286 Score = 40.4 bits (93), Expect = 0.002 Identities = 17/22 (77%), Positives = 20/22 (90%) Frame = -2 Query: 434 GPFIGAALAAIYHVVVIRAIPF 369 GP IGAALAAIYH ++IRA+PF Sbjct: 262 GPMIGAALAAIYHQIIIRAMPF 283
>LAS17_YEAST (Q12446) Proline-rich protein LAS17| Length = 633 Score = 36.6 bits (83), Expect = 0.027 Identities = 18/57 (31%), Positives = 28/57 (49%), Gaps = 3/57 (5%) Frame = +2 Query: 173 RRCRQAHTPRRDGRFENY---YSVRGRDTIHVRAHQQPPPPPHDRSTMNSDKIPSMA 334 ++ + H PR + +N Y+ DTI H+ PPPPP T +SD+ S + Sbjct: 148 QKSQVVHGPRGESLIDNQRKRYNYEDVDTIPTTKHKAPPPPPPTAETFDSDQTSSFS 204
>PIP22_ARATH (P43287) Aquaporin PIP2.2 (Plasma membrane intrinsic protein 2b)| (PIP2b) (TMP2b) Length = 285 Score = 35.8 bits (81), Expect = 0.046 Identities = 17/26 (65%), Positives = 19/26 (73%) Frame = -2 Query: 434 GPFIGAALAAIYHVVVIRAIPFKSRG 357 GPFIGAA+AA YH V+RA KS G Sbjct: 252 GPFIGAAIAAFYHQFVLRASGSKSLG 277
>PIP21_ARATH (P43286) Aquaporin PIP2.1 (Plasma membrane intrinsic protein 2a)| (PIP2a) Length = 287 Score = 35.8 bits (81), Expect = 0.046 Identities = 17/26 (65%), Positives = 19/26 (73%) Frame = -2 Query: 434 GPFIGAALAAIYHVVVIRAIPFKSRG 357 GPFIGAA+AA YH V+RA KS G Sbjct: 254 GPFIGAAIAAFYHQFVLRASGSKSLG 279
>PIP25_ORYSA (Q8GRI8) Aquaporin PIP2.5 (Plasma membrane intrinsic protein 2.5)| (OsPIP2.5) Length = 283 Score = 35.4 bits (80), Expect = 0.061 Identities = 14/19 (73%), Positives = 18/19 (94%) Frame = -2 Query: 434 GPFIGAALAAIYHVVVIRA 378 GPFIGAA+AA+YH +V+RA Sbjct: 253 GPFIGAAIAALYHQIVLRA 271
>PIP24_ORYSA (Q8GRT8) Aquaporin PIP2.4 (Plasma membrane intrinsic protein 2.4)| (OsPIP2.4) Length = 286 Score = 35.4 bits (80), Expect = 0.061 Identities = 14/19 (73%), Positives = 18/19 (94%) Frame = -2 Query: 434 GPFIGAALAAIYHVVVIRA 378 GPFIGAA+AA+YH V++RA Sbjct: 256 GPFIGAAIAALYHQVILRA 274
>PIP26_ARATH (Q9ZV07) Probable aquaporin PIP2.6 (Plasma membrane intrinsic| protein 2e) (PIP2e) Length = 289 Score = 34.7 bits (78), Expect = 0.10 Identities = 15/26 (57%), Positives = 19/26 (73%) Frame = -2 Query: 434 GPFIGAALAAIYHVVVIRAIPFKSRG 357 GPF+GAA+AA YH V+RA K+ G Sbjct: 253 GPFVGAAIAAFYHQFVLRAGAMKAYG 278
>PIP21_ORYSA (Q8H5N9) Probable aquaporin PIP2.1 (Plasma membrane intrinsic| protein 2a) (PIP2a) (OsPIP2.1) Length = 290 Score = 34.3 bits (77), Expect = 0.13 Identities = 14/26 (53%), Positives = 19/26 (73%) Frame = -2 Query: 434 GPFIGAALAAIYHVVVIRAIPFKSRG 357 GPF+GAA+AA YH ++RA K+ G Sbjct: 259 GPFVGAAIAAFYHQYILRAGAIKALG 284
>PIP23_ARATH (P30302) Aquaporin PIP2.3 (Plasma membrane intrinsic protein 2c)| (PIP2c) (TMP2C) (RD28-PIP) (Water stress-induced tonoplast intrinsic protein) (WSI-TIP) Length = 285 Score = 34.3 bits (77), Expect = 0.13 Identities = 16/26 (61%), Positives = 18/26 (69%) Frame = -2 Query: 434 GPFIGAALAAIYHVVVIRAIPFKSRG 357 GPFIGA +AA YH V+RA KS G Sbjct: 252 GPFIGATIAAFYHQFVLRASGSKSLG 277
>PIP25_ARATH (Q9SV31) Probable aquaporin PIP2.5 (Plasma membrane intrinsic| protein 2d) (PIP2d) Length = 286 Score = 33.9 bits (76), Expect = 0.18 Identities = 16/31 (51%), Positives = 21/31 (67%) Frame = -2 Query: 434 GPFIGAALAAIYHVVVIRAIPFKSRG*WTNQ 342 GPF GAA+AA YH V+RA K+ G + +Q Sbjct: 253 GPFAGAAIAAFYHQFVLRAGAIKALGSFRSQ 283
>PIP24_ARATH (Q9FF53) Probable aquaporin PIP2.4 (Plasma membrane intrinsic| protein 2.4) Length = 291 Score = 32.3 bits (72), Expect = 0.51 Identities = 14/26 (53%), Positives = 17/26 (65%) Frame = -2 Query: 434 GPFIGAALAAIYHVVVIRAIPFKSRG 357 GP IGAA AA YH ++RA K+ G Sbjct: 254 GPMIGAAAAAFYHQFILRAAAIKALG 279
>PIP26_ORYSA (Q7XLR1) Probable aquaporin PIP2.6 (Plasma membrane intrinsic| protein 2.6) (OsPIP2.6) Length = 282 Score = 32.3 bits (72), Expect = 0.51 Identities = 14/26 (53%), Positives = 17/26 (65%) Frame = -2 Query: 434 GPFIGAALAAIYHVVVIRAIPFKSRG 357 GPFIGA AA YH ++RA K+ G Sbjct: 249 GPFIGALAAAAYHQYILRAAAIKALG 274
>PIP1_ATRCA (P42767) Aquaporin PIP-type| Length = 282 Score = 32.3 bits (72), Expect = 0.51 Identities = 14/26 (53%), Positives = 17/26 (65%) Frame = -2 Query: 434 GPFIGAALAAIYHVVVIRAIPFKSRG 357 GPF+GA AA YH V+RA K+ G Sbjct: 249 GPFVGALAAAAYHQYVLRAAAIKALG 274
>INADL_MOUSE (Q63ZW7) InaD-like protein (Inadl protein) (Pals1-associated tight| junction protein) (Protein associated to tight junctions) (Channel-interacting PDZ domain-containing protein) Length = 1834 Score = 31.6 bits (70), Expect = 0.87 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +2 Query: 254 HVRAHQQPPPPPHDRSTMNSDKIPSMAAQTDW 349 H+RA + PPPPH R + + + A T W Sbjct: 882 HLRAMESNPPPPHIREAAPASPVLELQAGTQW 913
>PIP27_ARATH (P93004) Aquaporin PIP2.7 (Plasma membrane intrinsic protein 3)| (Salt stress-induced major intrinsic protein) Length = 280 Score = 31.2 bits (69), Expect = 1.1 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = -2 Query: 434 GPFIGAALAAIYHVVVIRAIPFKSRG 357 GPF+GA AA YH ++RA K+ G Sbjct: 247 GPFLGALAAAAYHQYILRASAIKALG 272
>PIP23_ORYSA (Q7XUA6) Probable aquaporin PIP2.3 (Plasma membrane intrinsic| protein 2.3) (OsPIP2.3) Length = 290 Score = 30.4 bits (67), Expect = 1.9 Identities = 13/19 (68%), Positives = 15/19 (78%) Frame = -2 Query: 434 GPFIGAALAAIYHVVVIRA 378 GP IGAA+AA YH V+RA Sbjct: 259 GPLIGAAIAAAYHQYVLRA 277
>PIP28_ARATH (Q9ZVX8) Probable aquaporin PIP2.8 (Plasma membrane intrinsic| protein 3b) (PIP3b) Length = 278 Score = 30.4 bits (67), Expect = 1.9 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = -2 Query: 434 GPFIGAALAAIYHVVVIRAIPFKS 363 GPF+GA AA YH ++RA K+ Sbjct: 245 GPFVGALAAAAYHQYILRAAAIKA 268
>PIP22_ORYSA (Q6K215) Probable aquaporin PIP2.2 (Plasma membrane intrinsic| protein 2.2) (OsPIP2.2) Length = 288 Score = 30.4 bits (67), Expect = 1.9 Identities = 13/19 (68%), Positives = 15/19 (78%) Frame = -2 Query: 434 GPFIGAALAAIYHVVVIRA 378 GP IGAA+AA YH V+RA Sbjct: 258 GPLIGAAIAAAYHQYVLRA 276
>RS5_HALSA (Q9HPB4) 30S ribosomal protein S5P| Length = 212 Score = 30.0 bits (66), Expect = 2.5 Identities = 17/52 (32%), Positives = 26/52 (50%) Frame = -1 Query: 435 GTVHRRGAGGDLPRGGDQGDPLQEPRLVDQSVWAAMDGILSLFIVDRSCGGG 280 G + + G D+ D G PL+EP +VDQ + D +L + +V R G Sbjct: 14 GGLVQDGEVEDMSEALDTGLPLKEPEIVDQLLPGLDDEVLDINMVQRMTDSG 65
>RL4_HALMA (P12735) 50S ribosomal protein L4P (Hmal4) (Hl6)| Length = 246 Score = 28.5 bits (62), Expect = 7.4 Identities = 20/54 (37%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = +2 Query: 185 QAHTPRRDGRFENY-YSVRGRDTIHVRAHQQPPPPPHDRSTMNSDKIPSMAAQT 343 QAH P++DGR +V+GR AH PP DRS +DK +A ++ Sbjct: 67 QAHVPKQDGRARRVPQAVKGRS-----AH--PPKTEKDRSLDLNDKERQLAVRS 113
>NONO_PONPY (Q5RFL9) Non-POU domain-containing octamer-binding protein (NonO| protein) Length = 471 Score = 28.5 bits (62), Expect = 7.4 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +2 Query: 182 RQAHTPRRDGRFENYYSVRGRDTIHVRAHQQPPPPP 289 +Q HTPR+ ++ + H + QQPPPPP Sbjct: 11 KQNHTPRK------HHQHHHQQQHHQQQQQQPPPPP 40
>NONO_HUMAN (Q15233) Non-POU domain-containing octamer-binding protein (NonO| protein) (54 kDa nuclear RNA- and DNA-binding protein) (p54(nrb)) (p54nrb) (55 kDa nuclear protein) (NMT55) (DNA-binding p52/p100 complex, 52 kDa subunit) Length = 471 Score = 28.5 bits (62), Expect = 7.4 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +2 Query: 182 RQAHTPRRDGRFENYYSVRGRDTIHVRAHQQPPPPP 289 +Q HTPR+ ++ + H + QQPPPPP Sbjct: 11 KQNHTPRK------HHQHHHQQQHHQQQQQQPPPPP 40
>HYIN1_AGRVI (Q04557) Indoleacetamide hydrolase (EC 3.5.1.-) (IAH)| (Indole-3-acetamide hydrolase) Length = 462 Score = 28.1 bits (61), Expect = 9.7 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +2 Query: 173 RRCRQAHTPRRDGRFENYYSVRGRDTI 253 RR + + PR +ENYYS G D + Sbjct: 346 RRALRCYKPRLKATYENYYSSNGLDAV 372
>PIP28_ORYSA (Q7Y1E6) Probable aquaporin PIP2.8 (Plasma membrane intrinsic| protein 2.8) (OsPIP2.8) Length = 280 Score = 28.1 bits (61), Expect = 9.7 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = -2 Query: 434 GPFIGAALAAIYHVVVIRAIPFKS 363 GPF GAA A IYH ++R K+ Sbjct: 246 GPFAGAAAAMIYHHYILRGAAAKA 269
>NPHP4_MOUSE (P59240) Nephrocystin-4 (Nephroretinin)| Length = 1425 Score = 28.1 bits (61), Expect = 9.7 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = -1 Query: 408 GDLPRGGDQGDPLQEPRLVDQSVWAAMDGILSLF 307 G LP GD GD L++PR + W D +L+ Sbjct: 219 GLLPPHGDTGDALRKPRFQKPTTWHLDDLFFTLY 252
>NO75_LUPLU (Q06841) Early nodulin 75 protein (N-75) (NGM-75) (Fragment)| Length = 434 Score = 28.1 bits (61), Expect = 9.7 Identities = 10/23 (43%), Positives = 17/23 (73%), Gaps = 3/23 (13%) Frame = +2 Query: 251 IHVRAHQQPP---PPPHDRSTMN 310 +H +H++PP PPPH++S M+ Sbjct: 267 VHPPSHEKPPFVYPPPHEKSPMH 289 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 57,882,450 Number of Sequences: 219361 Number of extensions: 1207416 Number of successful extensions: 5702 Number of sequences better than 10.0: 36 Number of HSP's better than 10.0 without gapping: 4430 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5226 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2511994855 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)