| Clone Name | rbart23c12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ZDH20_MOUSE (Q5Y5T1) Probable palmitoyltransferase ZDHHC20 (EC 2... | 30 | 3.8 | 2 | AGL11_ARATH (Q38836) Agamous-like MADS-box protein AGL11 | 29 | 6.4 |
|---|
>ZDH20_MOUSE (Q5Y5T1) Probable palmitoyltransferase ZDHHC20 (EC 2.3.1.-) (Zinc| finger DHHC domain-containing protein 20) (DHHC-20) Length = 380 Score = 29.6 bits (65), Expect = 3.8 Identities = 16/39 (41%), Positives = 20/39 (51%) Frame = -2 Query: 122 CCVRCVTWSALPFPTFIFASYSTLHYHLGLCVSLFVRVG 6 CC R V W + F TF+ +S Y + LCVS R G Sbjct: 9 CCQRVVGWVPVLFITFVVV-WSYYAYVVELCVSTISRTG 46
>AGL11_ARATH (Q38836) Agamous-like MADS-box protein AGL11| Length = 230 Score = 28.9 bits (63), Expect = 6.4 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -3 Query: 379 TKAKLFRRFHQHHHAHDSENEVDEVEELARK 287 TK R+ QHHH S +E++ +E LA + Sbjct: 169 TKVAEVERYQQHHHQMVSGSEINAIEALASR 199 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,931,611 Number of Sequences: 219361 Number of extensions: 661081 Number of successful extensions: 2488 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2184 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2436 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2851757076 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)