| Clone Name | rbart23c06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YMO3_YEAST (Q03673) Hypothetical 22.7 kDa protein in CDC5-MVP1 i... | 30 | 3.1 | 2 | MRAZ_BACFR (Q64ZL3) Protein mraZ | 30 | 4.0 | 3 | MRAZ_BACFN (Q5LII9) Protein mraZ | 30 | 4.0 | 4 | HUL4_YEAST (P40985) Probable ubiquitin-protein ligase HUL4 (EC 6... | 28 | 8.9 |
|---|
>YMO3_YEAST (Q03673) Hypothetical 22.7 kDa protein in CDC5-MVP1 intergenic| region Length = 198 Score = 30.0 bits (66), Expect = 3.1 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = -1 Query: 305 KMCKMHCSSCNPPLKFRTSDLLSRLRNHDSSGN 207 K+ K C S L R SDLL RL HDS N Sbjct: 75 KVLKEQCKSRGLKLSGRKSDLLQRLITHDSCSN 107
>MRAZ_BACFR (Q64ZL3) Protein mraZ| Length = 158 Score = 29.6 bits (65), Expect = 4.0 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = -2 Query: 448 WNKEVGEARKRLHKWEGN 395 WN+E+ E R+RL+KW N Sbjct: 55 WNEELDELRQRLNKWNAN 72
>MRAZ_BACFN (Q5LII9) Protein mraZ| Length = 158 Score = 29.6 bits (65), Expect = 4.0 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = -2 Query: 448 WNKEVGEARKRLHKWEGN 395 WN+E+ E R+RL+KW N Sbjct: 55 WNEELDELRQRLNKWNAN 72
>HUL4_YEAST (P40985) Probable ubiquitin-protein ligase HUL4 (EC 6.3.2.-) (HECT| ubiquitin ligase 4) Length = 892 Score = 28.5 bits (62), Expect = 8.9 Identities = 18/72 (25%), Positives = 32/72 (44%) Frame = -1 Query: 464 HCEDRLEQRGRRSEEKIA*VGRQQGASVSRPGMKQLIVYMISRDGVRSQVDLPKMCKMHC 285 H ++RL + GRR+ E+ + G+ + K+ S V + D + ++C Sbjct: 30 HTKNRLPKSGRRTSERSLAASVKDGSCSNSKSNKRN-----SSASVSGEEDKSCLISLNC 84 Query: 284 SSCNPPLKFRTS 249 C PL+F S Sbjct: 85 LCCGVPLRFPAS 96 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 64,082,500 Number of Sequences: 219361 Number of extensions: 1209239 Number of successful extensions: 2724 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2675 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2724 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 3026354448 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)