Clone Name | rbart23c05 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | LIPA_RHOBA (Q7UH37) Lipoyl synthase (EC 2.8.1.-) (Lipoic acid sy... | 29 | 5.0 | 2 | SCC2_ASHGO (Q750S2) Sister chromatid cohesion protein 2 | 28 | 8.6 |
---|
>LIPA_RHOBA (Q7UH37) Lipoyl synthase (EC 2.8.1.-) (Lipoic acid synthase)| (Lipoate synthase) (Lipoyl-acyl-carrier protein synthase) (Sulfur insertion protein lipA) (Lip-syn) Length = 316 Score = 29.3 bits (64), Expect = 5.0 Identities = 12/30 (40%), Positives = 21/30 (70%) Frame = -2 Query: 200 EEQGKVHSSLSEILKQDDSFRSVGAYLLPG 111 EE+G++ +LS++ + D F ++G YL PG Sbjct: 238 EERGELLDALSDLREHDVDFLTLGQYLQPG 267
>SCC2_ASHGO (Q750S2) Sister chromatid cohesion protein 2| Length = 1479 Score = 28.5 bits (62), Expect = 8.6 Identities = 16/35 (45%), Positives = 21/35 (60%), Gaps = 2/35 (5%) Frame = -3 Query: 214 MNTNMRNRGKYIPVFQK--F*NKTIHSVPWELICY 116 M+TN RNR K++ V +K F N SV +E CY Sbjct: 1305 MSTNKRNRSKFLKVVKKTVFSNYLSTSVNYEESCY 1339 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 64,538,221 Number of Sequences: 219361 Number of extensions: 1241326 Number of successful extensions: 2198 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2149 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2198 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2909956200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)