Clone Name | rbart23b11 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | DYI3_CHLRE (P27766) Dynein, 70 kDa intermediate chain, flagellar... | 30 | 2.7 | 2 | POLS_ONNVG (P22056) Structural polyprotein (p130) [Contains: Cap... | 29 | 4.5 | 3 | RHG12_MOUSE (Q8C0D4) Rho-GTPase-activating protein 12 | 28 | 7.7 | 4 | BRC4_DROME (Q24206) Broad-complex core-protein isoform 6 | 28 | 7.7 | 5 | BRC1_DROME (Q01295) Broad-complex core-protein isoforms 1/2/3/4/5 | 28 | 7.7 |
---|
>DYI3_CHLRE (P27766) Dynein, 70 kDa intermediate chain, flagellar outer arm| (IC69) (IC70) Length = 567 Score = 30.0 bits (66), Expect = 2.7 Identities = 14/38 (36%), Positives = 17/38 (44%) Frame = -1 Query: 197 PICSYIWSISCPNMIMYPSLSMVPVGLCCLVKLRHVSN 84 P+ SYIW ++ PN P MVP C K N Sbjct: 195 PLSSYIWDVNNPNT---PEYEMVPTSQICCAKFNLKDN 229
>POLS_ONNVG (P22056) Structural polyprotein (p130) [Contains: Capsid protein| (EC 3.4.21.-) (Coat protein) (C); p62 (E3/E2); E3 protein (Spike glycoprotein E3); E2 envelope glycoprotein (Spike glycoprotein E2); 6K protein; E1 envelope glycoprotein (Spike g Length = 1247 Score = 29.3 bits (64), Expect = 4.5 Identities = 17/53 (32%), Positives = 24/53 (45%), Gaps = 4/53 (7%) Frame = -1 Query: 248 TVLYVYGWGEEIVNVLYPICSYIWSISCPNMIMYPS----LSMVPVGLCCLVK 102 T L V W ++IV + P S WS++ P M + + S P CC K Sbjct: 237 TALSVVTWNKDIVTKITPEGSVEWSLALPVMCLLANTTFPCSQPPCAPCCYEK 289
>RHG12_MOUSE (Q8C0D4) Rho-GTPase-activating protein 12| Length = 838 Score = 28.5 bits (62), Expect = 7.7 Identities = 16/37 (43%), Positives = 18/37 (48%), Gaps = 4/37 (10%) Frame = -2 Query: 358 ALPPWPASRGFGLHNYMEL----SGYCYYYFRTYDTR 260 ALPP P S ++ E SG CYYY RT R Sbjct: 253 ALPPLPGSPAIQVNGEWETHKDSSGRCYYYNRTTQER 289
>BRC4_DROME (Q24206) Broad-complex core-protein isoform 6| Length = 880 Score = 28.5 bits (62), Expect = 7.7 Identities = 18/62 (29%), Positives = 27/62 (43%), Gaps = 1/62 (1%) Frame = -3 Query: 312 TWNCRGTAITIFAPMIRV-APVYRSLCVWLGRRNRECALPYLFLHMVNFMPKHDYVSILK 136 T C G +I ++ +P +R L ++ C P + L VNFM H V + Sbjct: 35 TLACEGRSIKAHRVVLSACSPYFRELL-----KSTPCKHPVILLQDVNFMDLHALVEFIY 89 Query: 135 HG 130 HG Sbjct: 90 HG 91
>BRC1_DROME (Q01295) Broad-complex core-protein isoforms 1/2/3/4/5| Length = 727 Score = 28.5 bits (62), Expect = 7.7 Identities = 18/62 (29%), Positives = 27/62 (43%), Gaps = 1/62 (1%) Frame = -3 Query: 312 TWNCRGTAITIFAPMIRV-APVYRSLCVWLGRRNRECALPYLFLHMVNFMPKHDYVSILK 136 T C G +I ++ +P +R L ++ C P + L VNFM H V + Sbjct: 35 TLACEGRSIKAHRVVLSACSPYFRELL-----KSTPCKHPVILLQDVNFMDLHALVEFIY 89 Query: 135 HG 130 HG Sbjct: 90 HG 91 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 62,246,173 Number of Sequences: 219361 Number of extensions: 1275878 Number of successful extensions: 2595 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2540 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2595 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2628831825 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)