| Clone Name | rbart22h12 |
|---|---|
| Clone Library Name | barley_pub |
>NET2_CHICK (Q90923) Netrin-2 precursor (Fragment)| Length = 581 Score = 31.6 bits (70), Expect = 0.93 Identities = 20/66 (30%), Positives = 31/66 (46%) Frame = +2 Query: 203 ILSSNECGHRRSLDLSRSCQLSDVRRTNPSACEPGRQLLHLYLQHVSAVANVTCIPANTV 382 + +S+ CG + R C SD RR +P A YL ++ AN+TC + T+ Sbjct: 52 VQASSTCGKPPT----RHCDASDPRRAHPPA----------YLTDLNTAANMTCWRSETL 97 Query: 383 HPDSHH 400 H H+ Sbjct: 98 HHLPHN 103
>TNR7_HUMAN (P26842) Tumor necrosis factor receptor superfamily member 7| precursor (CD27L receptor) (T-cell activation antigen CD27) (T14) Length = 260 Score = 30.0 bits (66), Expect = 2.7 Identities = 17/41 (41%), Positives = 19/41 (46%), Gaps = 3/41 (7%) Frame = +2 Query: 296 CEPGRQLLHLYLQHVSAVANVTCIPANTVHPDSH---HCHS 409 CEPG L+ QH A CIP + PD H HC S Sbjct: 43 CEPGTFLVKDCDQHRKAAQCDPCIPGVSFSPDHHTRPHCES 83
>POLG_TMEVG (P08545) Genome polyprotein [Contains: Coat protein VP4 (P1A); Coat| protein VP2 (P1B); Coat protein VP3 (P1C); Coat protein VP1 (P1D); Picornain 2A (EC 3.4.22.29) (Core protein P2A); Core protein P2B; Core protein P2C; Core protein P3A; Genome Length = 2303 Score = 28.9 bits (63), Expect = 6.0 Identities = 18/54 (33%), Positives = 25/54 (46%), Gaps = 12/54 (22%) Frame = -3 Query: 263 AGNSGTSPGSG------------GDHTRCCLECSTDVVKYGDVYITITIAIFTT 138 AGNS T+ S G+H C + +TD V + Y TI +A +TT Sbjct: 166 AGNSATNTQSTVGRLCGYGKSHHGEHPTSCADAATDKVLAAERYYTIDLASWTT 219
>POLG_TMEVD (P13899) Genome polyprotein [Contains: Coat protein VP4 (P1A); Coat| protein VP2 (P1B); Coat protein VP3 (P1C); Coat protein VP1 (P1D); Picornain 2A (EC 3.4.22.29) (Core protein P2A); Core protein P2B; Core protein P2C; Core protein P3A; Genome Length = 2301 Score = 28.5 bits (62), Expect = 7.9 Identities = 18/54 (33%), Positives = 25/54 (46%), Gaps = 12/54 (22%) Frame = -3 Query: 263 AGNSGTSPGSG------------GDHTRCCLECSTDVVKYGDVYITITIAIFTT 138 AGNS T+ S G+H C + +TD V + Y TI +A +TT Sbjct: 166 AGNSATNTQSTVGRLCGYGEAHHGEHPASCADTATDKVLAAERYYTIDLASWTT 219
>SYA_IDILO (Q5QUV7) Alanyl-tRNA synthetase (EC 6.1.1.7) (Alanine--tRNA ligase)| (AlaRS) Length = 865 Score = 28.5 bits (62), Expect = 7.9 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = +1 Query: 49 RHVGGRYNTRPTAIAEREVQSRHSFRRFEQ 138 + + G T P+++AE+ Q +H FR E+ Sbjct: 705 QQIAGELKTEPSSVAEKVQQLQHKFRELER 734
>POLG_TMEVB (P08544) Genome polyprotein [Contains: Coat protein VP4 (P1A); Coat| protein VP2 (P1B); Coat protein VP3 (P1C); Coat protein VP1 (P1D); Picornain 2A (EC 3.4.22.29) (Core protein P2A); Core protein P2B; Core protein P2C; Core protein P3A; Genome Length = 2303 Score = 28.5 bits (62), Expect = 7.9 Identities = 18/54 (33%), Positives = 25/54 (46%), Gaps = 12/54 (22%) Frame = -3 Query: 263 AGNSGTSPGSG------------GDHTRCCLECSTDVVKYGDVYITITIAIFTT 138 AGNS T+ S G+H C + +TD V + Y TI +A +TT Sbjct: 166 AGNSATNTQSTVGRLCGYGKSHHGEHPASCADTATDKVLAAERYYTIDLASWTT 219
>NHR18_CAEEL (O16360) Nuclear hormone receptor family member nhr-18| Length = 394 Score = 28.5 bits (62), Expect = 7.9 Identities = 16/50 (32%), Positives = 24/50 (48%), Gaps = 9/50 (18%) Frame = +2 Query: 263 LSDVRRTNPSACEPGRQLLHLYLQH---------VSAVANVTCIPANTVH 385 + D+ NPS+ E LLHL L+H + A N+ + AN +H Sbjct: 286 IQDMIDLNPSSIEVSYMLLHLSLEHAGKRLHGDALDATENLVQVQANNLH 335
>YNM0_YEAST (P53922) Very hypothetical 17.9 kDa protein in TOM70-PSU1| intergenic region Length = 161 Score = 28.5 bits (62), Expect = 7.9 Identities = 13/41 (31%), Positives = 22/41 (53%) Frame = +2 Query: 197 CCILSSNECGHRRSLDLSRSCQLSDVRRTNPSACEPGRQLL 319 CC++ SN S+SC +S++ R S C+ G ++L Sbjct: 67 CCLVCSN----------SKSCTISNITRDPESECDKGSRIL 97 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 61,932,366 Number of Sequences: 219361 Number of extensions: 1113916 Number of successful extensions: 3344 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 3240 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3343 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2677159704 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)