| Clone Name | rbart22h09 |
|---|---|
| Clone Library Name | barley_pub |
>NU4M_ACACA (Q37375) NADH-ubiquinone oxidoreductase chain 4 (EC 1.6.5.3) (NADH| dehydrogenase subunit 4) Length = 497 Score = 29.6 bits (65), Expect = 2.0 Identities = 11/35 (31%), Positives = 23/35 (65%) Frame = -2 Query: 141 VLCHFLLFFPSYSTLHYHLGFMYCFVYLLVYLRGS 37 ++ ++ L F +S + +GF++CF+ +L L+GS Sbjct: 446 LVVNYYLRFSDFSKKEFVVGFIFCFITILFGLKGS 480
>O52E2_HUMAN (Q8NGJ4) Olfactory receptor 52E2| Length = 325 Score = 29.3 bits (64), Expect = 2.6 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = -2 Query: 126 LLFFPSYSTLHYHLGFMYCFVYLLVYLRGSGDYT 25 LL P TLH +GF +C VY++ + G++T Sbjct: 16 LLGIPGLETLHIWIGFPFCAVYMIALI---GNFT 46
>RT03_ACACA (P46754) Mitochondrial ribosomal protein S3| Length = 298 Score = 28.9 bits (63), Expect = 3.4 Identities = 18/61 (29%), Positives = 32/61 (52%), Gaps = 1/61 (1%) Frame = -3 Query: 203 FGRLITLVNLFPVLCVMRDV*CSAISYFFFLRIPRYITTW-VLCTALFIC*FICEGREII 27 F R L +F + +V + IS FFF+R+ +Y T W VL F+ + + R+++ Sbjct: 169 FSRSSFLSKIFIIGLSKMNVNANIISEFFFIRLTQYYTIWEVLRNINFLFKSLMKKRKLV 228 Query: 26 R 24 + Sbjct: 229 K 229
>NOS2_CAVPO (O54705) Nitric oxide synthase, inducible (EC 1.14.13.39) (NOS type| II) (Inducible NO synthase) (Inducible NOS) (iNOS) Length = 1149 Score = 28.1 bits (61), Expect = 5.8 Identities = 17/47 (36%), Positives = 22/47 (46%) Frame = +3 Query: 24 SYNLPTLANKLTNKQSST*NPSGNVTWNTKEKKVGNGRALHVTHHTQ 164 S +L A K+ QS PS + + K K GNG L T HT+ Sbjct: 56 SQSLTGTAKKVPESQSKPHKPSPTCSQHMKIKNWGNGMILQDTLHTK 102
>GPMA_THEFY (Q47KS8) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase| (EC 5.4.2.1) (Phosphoglyceromutase) (PGAM) (BPG-dependent PGAM) (dPGM) Length = 247 Score = 28.1 bits (61), Expect = 5.8 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +2 Query: 191 LNDQINQAPAGGTYVDLESVQEALEPV 271 LND GG Y+D E+ +EA+E V Sbjct: 216 LNDDFTPRKTGGEYLDPEAAKEAIEAV 242
>O51G1_HUMAN (Q8NGK1) Olfactory receptor 51G1| Length = 321 Score = 28.1 bits (61), Expect = 5.8 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = -2 Query: 129 FLLFFPSYSTLHYHLGFMYCFVYLLVYLRGSGDYTSSNVMC 7 FL F LH + +CF+YL V L G+ T +V+C Sbjct: 15 FLTGFQGLEGLHGWISIPFCFIYLTVIL---GNLTILHVIC 52
>O52E4_HUMAN (Q8NGH9) Olfactory receptor 52E4| Length = 312 Score = 27.7 bits (60), Expect = 7.6 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = -2 Query: 126 LLFFPSYSTLHYHLGFMYCFVYLL 55 LL P TLH + F +C VYL+ Sbjct: 16 LLGIPGLDTLHIWISFPFCIVYLI 39
>SGO2_SCHPO (O13734) Shugoshin-2| Length = 647 Score = 27.7 bits (60), Expect = 7.6 Identities = 23/93 (24%), Positives = 36/93 (38%), Gaps = 9/93 (9%) Frame = +3 Query: 9 TSHCCSYNLPTLANKLTNKQSST*NPSGNVTWNTKEKKVGNGRALHVTHHTQYREQINQS 188 T+ SYN L + +TN +S N T + +E KV R + ++ +N+ Sbjct: 506 TNDTGSYNNLELLSSVTNLKSPNENDRVTKTQSRRETKVKRRRKARIQETSEESTVVNEP 565 Query: 189 N*TTKSTRRR---------PAVRTSI*NRFRRP 260 N RR P +RT + F P Sbjct: 566 NEKPDGRSRRERKKVNYALPGLRTKLRRNFDLP 598
>NFIP1_BRARE (Q6DGP4) NEDD4 family-interacting protein 1| Length = 210 Score = 27.3 bits (59), Expect = 10.0 Identities = 13/48 (27%), Positives = 24/48 (50%) Frame = -2 Query: 144 VVLCHFLLFFPSYSTLHYHLGFMYCFVYLLVYLRGSGDYTSSNVMCFS 1 +++ F +FP Y Y L +++ + L++LRG +Y M S Sbjct: 150 ILIVRFSTYFPGYFDGQYWLWWVFLVLGFLLFLRGFINYAKIRKMADS 197
>MDLB_BUCAP (Q8K984) Multidrug resistance-like ATP-binding protein mdlB (EC| 3.6.3.44) Length = 580 Score = 27.3 bits (59), Expect = 10.0 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = -2 Query: 144 VVLCHFLLFFPSYSTLHYHLGFMYCFVYLL 55 +VLC F+ F +S Y +G +Y F+ L Sbjct: 262 LVLCSFMFLFSYFSIGVYEVGVLYAFITYL 291 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,044,286 Number of Sequences: 219361 Number of extensions: 791183 Number of successful extensions: 1674 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1643 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1674 length of database: 80,573,946 effective HSP length: 79 effective length of database: 63,244,427 effective search space used: 1517866248 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)