Clone Name | rbart22g10 |
---|---|
Clone Library Name | barley_pub |
>PEBA_SYNPX (Q7U4P7) 15,16-dihydrobiliverdin:ferredoxin oxidoreductase (EC| 1.3.7.2) Length = 235 Score = 31.2 bits (69), Expect = 0.73 Identities = 20/76 (26%), Positives = 30/76 (39%) Frame = -2 Query: 248 DALEKIRERLPKVRS*KRCGALMCPIYKSIWLVICQGDALVADKLVPKRKVVGFLLYPVR 69 D L+ + R P + + + Y S WL+ C+G + AD+ +PK Sbjct: 115 DGLKDLNARFPDLNGEETMRSFDPNQYFSSWLLFCRGGSEEADRSLPK------------ 162 Query: 68 IPVRDVFCLFLYIYWG 21 F FL YWG Sbjct: 163 -----AFSAFLKAYWG 173
>CLN8_CANFA (Q5JZQ7) Protein CLN8| Length = 288 Score = 29.3 bits (64), Expect = 2.8 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 3/23 (13%) Frame = +3 Query: 171 YWTHERTTSLLRP---HFGQPLP 230 YWTH++T LL P +F QP P Sbjct: 248 YWTHKKTQQLLNPVDWNFAQPAP 270
>PRKDC_XENLA (Q9DEI1) DNA-dependent protein kinase catalytic subunit (EC| 2.7.11.1) (DNA-PK catalytic subunit) (DNA-PKcs) Length = 4146 Score = 28.9 bits (63), Expect = 3.6 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = +3 Query: 138 PLADYQPNGLIYWTHERTTSLLRPHFGQPLPYL 236 PLAD N L YW+ + +L+P++ +P L Sbjct: 785 PLADVGLNALQYWSTNIPSDILKPYYKDIIPLL 817
>VGNM_SQMVM (P36341) Genome polyprotein M (RNA2 polyprotein) [Contains:| Movement protein (MP); Large coat protein (LCP) (Coat protein VP37); Small coat protein (SCP) (Coat protein VP23)] (Fragment) Length = 803 Score = 28.9 bits (63), Expect = 3.6 Identities = 16/59 (27%), Positives = 23/59 (38%), Gaps = 5/59 (8%) Frame = +2 Query: 80 TTEIQQLYVWEPVCQRQAR---PPGRLPTKWTYIL--DT*AHHISSTTSLWAASPLSFL 241 TT Q VW P C++ P W ++ T AH + W +PL+ L Sbjct: 351 TTSSQNAIVWNPACEKAVELTFNPNPCGDAWNFVFLQQTKAHFAVQCVTGWTTTPLTDL 409
>13S1_FAGES (O23878) 13S globulin seed storage protein 1 precursor| (Legumin-like protein 1) [Contains: 13S globulin seed storage protein 1 acidic chain; 13S globulin seed storage protein 1 basic chain] Length = 565 Score = 28.5 bits (62), Expect = 4.8 Identities = 15/51 (29%), Positives = 25/51 (49%), Gaps = 2/51 (3%) Frame = +3 Query: 36 EKQTKYISHGDPYRVQQKSNNFTFGNQFVSDKRVPLADY--QPNGLIYWTH 182 + +++ S GD Q +S F+ G+Q R+ D P G++ WTH Sbjct: 188 QSESEEFSRGDQRTRQSESEEFSRGDQHQKIFRIRDGDVIPSPAGVVQWTH 238
>RPOB_BACFR (Q64NJ7) DNA-directed RNA polymerase beta chain (EC 2.7.7.6) (RNAP| beta subunit) (Transcriptase beta chain) (RNA polymerase beta subunit) Length = 1270 Score = 28.1 bits (61), Expect = 6.2 Identities = 21/91 (23%), Positives = 37/91 (40%), Gaps = 16/91 (17%) Frame = +3 Query: 12 LDSPPVDIEKQTKYISHGDPYRVQQKSNNFT--FGNQFVSDKRVPLADYQPNGLIYWT-- 179 LD+PP +K+ Y + + + NNF F + ++ R + D GL Y Sbjct: 38 LDTPPEKRKKEGLYKVFAENFPIADTRNNFVLEFLDYYIDPPRYTIDDCIERGLTYSVPL 97 Query: 180 ------------HERTTSLLRPHFGQPLPYL 236 HE ++++ F P+PY+ Sbjct: 98 KAKLKLYCTDPDHEDFDTVIQDVFLGPIPYM 128
>RPOB_BACFN (Q5L897) DNA-directed RNA polymerase beta chain (EC 2.7.7.6) (RNAP| beta subunit) (Transcriptase beta chain) (RNA polymerase beta subunit) Length = 1270 Score = 28.1 bits (61), Expect = 6.2 Identities = 21/91 (23%), Positives = 37/91 (40%), Gaps = 16/91 (17%) Frame = +3 Query: 12 LDSPPVDIEKQTKYISHGDPYRVQQKSNNFT--FGNQFVSDKRVPLADYQPNGLIYWT-- 179 LD+PP +K+ Y + + + NNF F + ++ R + D GL Y Sbjct: 38 LDTPPEKRKKEGLYKVFAENFPIADTRNNFVLEFLDYYIDPPRYTIDDCIERGLTYSVPL 97 Query: 180 ------------HERTTSLLRPHFGQPLPYL 236 HE ++++ F P+PY+ Sbjct: 98 KAKLKLYCTDPDHEDFDTVIQDVFLGPIPYM 128
>PEBA_SYNPY (Q02189) 15,16-dihydrobiliverdin:ferredoxin oxidoreductase (EC| 1.3.7.2) Length = 236 Score = 28.1 bits (61), Expect = 6.2 Identities = 19/73 (26%), Positives = 29/73 (39%) Frame = -2 Query: 242 LEKIRERLPKVRS*KRCGALMCPIYKSIWLVICQGDALVADKLVPKRKVVGFLLYPVRIP 63 L+++ +R P + + + Y S WL+ C+G A AD +PK Sbjct: 117 LKELNQRFPDLNGEETMRSFDPNQYFSSWLLFCRGGAEQADLSLPK-------------- 162 Query: 62 VRDVFCLFLYIYW 24 F FL YW Sbjct: 163 ---AFSAFLKAYW 172 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,020,779 Number of Sequences: 219361 Number of extensions: 883081 Number of successful extensions: 2357 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 2339 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2357 length of database: 80,573,946 effective HSP length: 61 effective length of database: 67,192,925 effective search space used: 1612630200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)