Clone Name | rbart22e09 |
---|---|
Clone Library Name | barley_pub |
>DIC_HUMAN (Q9UBX3) Mitochondrial dicarboxylate carrier (Solute carrier family| 25 member 10) Length = 287 Score = 34.7 bits (78), Expect = 0.12 Identities = 15/36 (41%), Positives = 23/36 (63%) Frame = -3 Query: 455 CAMQTMKTGGPFKFYSGFPVYCVRIAPHVMMTWLFL 348 CA++T K G P FY G +R+ PH ++T++FL Sbjct: 240 CAVETAKLG-PLAFYKGLVPAGIRLIPHTVLTFVFL 274
>DIC_MOUSE (Q9QZD8) Mitochondrial dicarboxylate carrier (Solute carrier family| 25 member 10) Length = 287 Score = 33.1 bits (74), Expect = 0.34 Identities = 15/36 (41%), Positives = 23/36 (63%) Frame = -3 Query: 455 CAMQTMKTGGPFKFYSGFPVYCVRIAPHVMMTWLFL 348 CAM+T K G P F+ G +R+ PH ++T++FL Sbjct: 239 CAMETAKLG-PQAFFKGLFPAGIRLIPHTVLTFMFL 273
>OAC1_YEAST (P32332) Mitochondrial oxaloacetate transport protein| (Mitochondrial carrier protein PMT) Length = 324 Score = 31.2 bits (69), Expect = 1.3 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = -3 Query: 455 CAMQTMKTGGPFKFYSGFPVYCVRIAPHVMMTWLFL 348 C ++T++ G Y GF RIAPH +M F+ Sbjct: 271 CLVKTVRIEGVTALYKGFAAQVFRIAPHTIMCLTFM 306
>M2OM_RAT (P97700) Mitochondrial 2-oxoglutarate/malate carrier protein (OGCP)| (Solute carrier family 25 member 11) Length = 313 Score = 31.2 bits (69), Expect = 1.3 Identities = 11/34 (32%), Positives = 21/34 (61%) Frame = -3 Query: 449 MQTMKTGGPFKFYSGFPVYCVRIAPHVMMTWLFL 348 ++ ++ G F + GF Y R+ PH ++T++FL Sbjct: 266 LKVVRYEGFFSLWKGFTPYYARLGPHTVLTFIFL 299
>M2OM_MOUSE (Q9CR62) Mitochondrial 2-oxoglutarate/malate carrier protein (OGCP)| (Solute carrier family 25 member 11) Length = 313 Score = 31.2 bits (69), Expect = 1.3 Identities = 11/34 (32%), Positives = 21/34 (61%) Frame = -3 Query: 449 MQTMKTGGPFKFYSGFPVYCVRIAPHVMMTWLFL 348 ++ ++ G F + GF Y R+ PH ++T++FL Sbjct: 266 LKVVRYEGFFSLWKGFTPYYARLGPHTVLTFIFL 299
>M2OM_BOVIN (P22292) Mitochondrial 2-oxoglutarate/malate carrier protein (OGCP)| (Solute carrier family 25 member 11) Length = 313 Score = 30.8 bits (68), Expect = 1.7 Identities = 11/34 (32%), Positives = 21/34 (61%) Frame = -3 Query: 449 MQTMKTGGPFKFYSGFPVYCVRIAPHVMMTWLFL 348 ++ ++ G F + GF Y R+ PH ++T++FL Sbjct: 266 VKVVRYEGFFSLWKGFTPYYARLGPHTVLTFIFL 299
>M2OM_HUMAN (Q02978) Mitochondrial 2-oxoglutarate/malate carrier protein (OGCP)| (Solute carrier family 25 member 11) Length = 313 Score = 30.4 bits (67), Expect = 2.2 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = -3 Query: 428 GPFKFYSGFPVYCVRIAPHVMMTWLFL 348 G F + GF Y R+ PH ++T++FL Sbjct: 273 GFFSLWKGFTPYYARLGPHTVLTFIFL 299
>COX18_YEAST (P53239) Inner membrane protein COX18, mitochondrial precursor| (Cytochrome c oxidase assembly protein 18) Length = 316 Score = 29.3 bits (64), Expect = 4.9 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -1 Query: 301 SWRQYQSLLDTFNNFSAALHLPWLFLV 221 S+ +QS+ DTF A H+PW+ LV Sbjct: 34 SFSLFQSVADTFLTVHEASHIPWIVLV 60
>ARGJ_SYNEL (Q8DHN4) Arginine biosynthesis bifunctional protein argJ [Includes:| Glutamate N-acetyltransferase (EC 2.3.1.35) (Ornithine acetyltransferase) (Ornithine transacetylase) (OATase); Amino-acid acetyltransferase (EC 2.3.1.1) (N-acetylglutamate syn Length = 419 Score = 28.5 bits (62), Expect = 8.4 Identities = 15/40 (37%), Positives = 19/40 (47%) Frame = +1 Query: 1 KISNGLN*AYTIQDQMAQAAKQVVVSHGCAQPTEVCRQKL 120 K S + A + D A AA +H CA P CRQ+L Sbjct: 27 KASGAPDLALIVSDVPAIAAGVFTTNHMCAAPVRYCRQRL 66 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 65,211,984 Number of Sequences: 219361 Number of extensions: 1172893 Number of successful extensions: 3038 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 2973 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3038 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2851757076 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)