Clone Name | rbart22e08 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | PI4K_DICDI (P54677) Phosphatidylinositol 4-kinase (EC 2.7.1.67) ... | 28 | 8.6 | 2 | D250_ASFB7 (P32092) Protein D250R | 28 | 8.6 |
---|
>PI4K_DICDI (P54677) Phosphatidylinositol 4-kinase (EC 2.7.1.67) (PI4-kinase)| (PtdIns-4-kinase) (PI4K-alpha) Length = 1093 Score = 27.7 bits (60), Expect = 8.6 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = +1 Query: 73 TASFHNLKK*KGRSNTTLNHFVITWKTPREIPWSSTKKNKI 195 T S HNLKK T LN+F T+ P + + + + N I Sbjct: 889 TMSLHNLKKSTPGFTTLLNYFKSTYGDPSGLRFRTAQSNFI 929
>D250_ASFB7 (P32092) Protein D250R| Length = 250 Score = 27.7 bits (60), Expect = 8.6 Identities = 14/48 (29%), Positives = 22/48 (45%), Gaps = 8/48 (16%) Frame = +3 Query: 69 YYSILPQLKKVKGSFQ--------HYLEPFCNNMENPKGNSLVFYKKK 188 YY ILP+ KK F ++L C ++E P N + Y+ + Sbjct: 158 YYQILPEFKKSMSYFDGKTEYKHIYFLAMLCKSLEEPNMNLSLQYENR 205 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 34,563,915 Number of Sequences: 219361 Number of extensions: 618621 Number of successful extensions: 1584 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1562 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1584 length of database: 80,573,946 effective HSP length: 43 effective length of database: 71,141,423 effective search space used: 1707394152 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)