Clone Name | rbart22e02 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | EFG_CHLTE (Q8KAG9) Elongation factor G (EF-G) | 28 | 9.0 |
---|
>EFG_CHLTE (Q8KAG9) Elongation factor G (EF-G)| Length = 704 Score = 28.1 bits (61), Expect = 9.0 Identities = 16/57 (28%), Positives = 26/57 (45%) Frame = +3 Query: 180 IYYHLRTWNHKFTTILENRRVVINFEDKSAQGNLYCSNAASCPWTDPWESWTGTSHR 350 +YY R HK + E + E + +G S A +C WT + ++ G +HR Sbjct: 31 LYYTGRL--HKMGEVHEGGATMDWMEQEKERGITITSAATTCFWTPKYGNYAGLNHR 85 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 60,693,191 Number of Sequences: 219361 Number of extensions: 1096526 Number of successful extensions: 2872 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 2824 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2872 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2336739400 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)