Clone Name | rbart22b12 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | YMDA_CHLAU (Q45826) Hypothetical RNA pseudouridine synthase in m... | 32 | 0.87 | 2 | YN81_CAEEL (Q03610) Hypothetical protein ZC84.1 in chromosome III | 28 | 7.4 | 3 | NOSZ_BRAJA (Q89XJ6) Nitrous-oxide reductase precursor (EC 1.7.99... | 28 | 9.7 |
---|
>YMDA_CHLAU (Q45826) Hypothetical RNA pseudouridine synthase in mdh 5'region| (EC 5.4.99.-) (RNA-uridine isomerase) (RNA pseudouridylate synthase) (ORFA) (Fragment) Length = 253 Score = 31.6 bits (70), Expect = 0.87 Identities = 16/46 (34%), Positives = 22/46 (47%) Frame = +3 Query: 258 LRTLYHLLVQGRCPPRFFIADGPLGAQPLCKMEQLSLVDSHPLRHH 395 +R +Y LV GR PP D P+G P ++ + D P R H Sbjct: 113 MRKIYQALVIGR-PPETGTIDAPIGRDPRDRLRMAVVPDGRPARTH 157
>YN81_CAEEL (Q03610) Hypothetical protein ZC84.1 in chromosome III| Length = 1416 Score = 28.5 bits (62), Expect = 7.4 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = -1 Query: 382 GWESTRESCSILQSGCAPRGPSAMKNLGGHLPC 284 G E C + QS C PRG + K+L GH C Sbjct: 1032 GMSGEPEKCVVGQSNC-PRGFACQKSLAGHHVC 1063
>NOSZ_BRAJA (Q89XJ6) Nitrous-oxide reductase precursor (EC 1.7.99.6) (N(2)OR)| (N2O reductase) Length = 650 Score = 28.1 bits (61), Expect = 9.7 Identities = 12/29 (41%), Positives = 14/29 (48%) Frame = -1 Query: 382 GWESTRESCSILQSGCAPRGPSAMKNLGG 296 GW T ES +L G P +KN GG Sbjct: 111 GWGQTNESLKVLTEGMQPATREFLKNRGG 139 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 61,418,681 Number of Sequences: 219361 Number of extensions: 1202106 Number of successful extensions: 2563 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2489 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2562 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2511994855 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)