| Clone Name | rbart22b03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | HEMA_CVPIA (Q8JSP9) Hemagglutinin-esterase precursor (EC 3.1.1.5... | 30 | 4.4 | 2 | HEMA_CVP67 (Q8BB26) Hemagglutinin-esterase precursor (EC 3.1.1.5... | 30 | 4.4 | 3 | EXEC1_ARATH (Q93YW0) EXECUTER1 protein, chloroplast precursor | 29 | 5.7 | 4 | ALA12_ARATH (P57792) Putative phospholipid-transporting ATPase 1... | 29 | 7.5 |
|---|
>HEMA_CVPIA (Q8JSP9) Hemagglutinin-esterase precursor (EC 3.1.1.53) (HE) (E3| glycoprotein) Length = 424 Score = 29.6 bits (65), Expect = 4.4 Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 1/48 (2%) Frame = -1 Query: 187 PDFLFSFCPPIVWTIVSAAALCI-SILPMFNMGLNLGVC*LFIVTLLI 47 P F F CP I S +C+ LP+ +G+ LGV + IV LL+ Sbjct: 364 PLFPFGNCPTAASIISSDLPICVYDPLPIILLGILLGVAVIVIVVLLL 411
>HEMA_CVP67 (Q8BB26) Hemagglutinin-esterase precursor (EC 3.1.1.53) (HE) (E3| glycoprotein) Length = 424 Score = 29.6 bits (65), Expect = 4.4 Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 1/48 (2%) Frame = -1 Query: 187 PDFLFSFCPPIVWTIVSAAALCI-SILPMFNMGLNLGVC*LFIVTLLI 47 P F F CP I S +C+ LP+ +G+ LGV + IV LL+ Sbjct: 364 PLFPFGNCPTAASIISSDLPICVYDPLPIILLGILLGVAVIVIVVLLL 411
>EXEC1_ARATH (Q93YW0) EXECUTER1 protein, chloroplast precursor| Length = 684 Score = 29.3 bits (64), Expect = 5.7 Identities = 14/33 (42%), Positives = 18/33 (54%), Gaps = 2/33 (6%) Frame = +3 Query: 264 NPRWHSTV--VYFSACRRLCLLLPWFVLLSRDD 356 NPRW S + V SA +R +L W+ L DD Sbjct: 64 NPRWDSAIQDVLKSAIKRFDSVLSWYATLDNDD 96
>ALA12_ARATH (P57792) Putative phospholipid-transporting ATPase 12 (EC 3.6.3.1)| (Aminophospholipid flippase 12) Length = 1184 Score = 28.9 bits (63), Expect = 7.5 Identities = 19/63 (30%), Positives = 31/63 (49%), Gaps = 1/63 (1%) Frame = +3 Query: 27 AANKLERINKVTINN*QTPRFKPILNIGKMEIHKAAAETIVHTI-GGQKENKKSGGVQRS 203 A + L R K I N +TP + + G+ + A E ++H I G+ + K SGG ++ Sbjct: 745 ACSLLRRDMKQIIINLETPEIQQLEKSGEKDAIAALKENVLHQITSGKAQLKASGGNAKA 804 Query: 204 ILL 212 L Sbjct: 805 FAL 807 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 71,159,174 Number of Sequences: 219361 Number of extensions: 1509287 Number of successful extensions: 3871 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3755 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3869 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3304846491 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)