Clone Name | rbart22b02 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | YID7_YEAST (P40534) Hypothetical 75.0 kDa protein in NOT3-CKA1 i... | 30 | 3.6 | 2 | DRE2A_ARATH (O82132) Dehydration-responsive element-binding prot... | 30 | 4.7 | 3 | NFM_HUMAN (P07197) Neurofilament triplet M protein (160 kDa neur... | 29 | 7.9 |
---|
>YID7_YEAST (P40534) Hypothetical 75.0 kDa protein in NOT3-CKA1 intergenic| region Length = 656 Score = 30.0 bits (66), Expect = 3.6 Identities = 19/55 (34%), Positives = 29/55 (52%) Frame = +3 Query: 87 TNSKKNKNPNRGSSIWLAKLPTLAKRNSAHNSSNDVALLSSTKTKHVTSYEIIKK 251 T+S + N R S+ WL KRN N N++++LS T+ +S IIK+ Sbjct: 243 TSSTLSLNFLRNSTDWLQ-----LKRNFTANLQNEISILSGGSTEVTSSTSIIKR 292
>DRE2A_ARATH (O82132) Dehydration-responsive element-binding protein 2A (DREB2A| protein) Length = 335 Score = 29.6 bits (65), Expect = 4.7 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +3 Query: 105 KNPNRGSSIWLAKLPTLAKRNSAHNSS 185 + PNRGS +WL PT + SA++ + Sbjct: 95 REPNRGSRLWLGTFPTAQEAASAYDEA 121
>NFM_HUMAN (P07197) Neurofilament triplet M protein (160 kDa neurofilament| protein) (Neurofilament medium polypeptide) (NF-M) (Neurofilament 3) Length = 915 Score = 28.9 bits (63), Expect = 7.9 Identities = 14/56 (25%), Positives = 30/56 (53%) Frame = +3 Query: 84 RTNSKKNKNPNRGSSIWLAKLPTLAKRNSAHNSSNDVALLSSTKTKHVTSYEIIKK 251 +T K G++ ++ K T+ ++ H + + L+S+ K + VTS+ I+K+ Sbjct: 855 KTVEKITSEGGDGATKYITKSVTVTQKVEEHEETFEEKLVSTKKVEKVTSHAIVKE 910 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 68,715,219 Number of Sequences: 219361 Number of extensions: 1279341 Number of successful extensions: 3404 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3344 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3404 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3523384522 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)