ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbart22b01 |
|---|---|
| Clone Library Name | barley_pub |
>PIP13_ORYSA (Q9SXF8) Aquaporin PIP 1.3 (Plasma membrane intrinsic protein 1.3)| (OsPIP1.3) (Water channel protein RWC3) (RWC-3) Length = 288 Score = 50.1 bits (118), Expect = 3e-06 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -3 Query: 446 PFIGAALAAIYHVVVIRAIPFKSR 375 PFIGAALAAIYHVVVIRAIPFKSR Sbjct: 264 PFIGAALAAIYHVVVIRAIPFKSR 287
>PIP11_VICFA (P61838) Aquaporin PIP1.1 (Plasma membrane intrinsic protein 1a)| (PIP1a) (Aquaporin 1) (Plasma membrane aquaporin 1) Length = 286 Score = 49.3 bits (116), Expect = 4e-06 Identities = 23/24 (95%), Positives = 24/24 (100%) Frame = -3 Query: 446 PFIGAALAAIYHVVVIRAIPFKSR 375 PFIGAALAA+YHVVVIRAIPFKSR Sbjct: 262 PFIGAALAALYHVVVIRAIPFKSR 285
>PIP11_ARATH (P61837) Aquaporin PIP1.1 (Plasma membrane intrinsic protein 1a)| (PIP1a) (Aquaporin 1) (Plasma membrane aquaporin 1) Length = 286 Score = 49.3 bits (116), Expect = 4e-06 Identities = 23/24 (95%), Positives = 24/24 (100%) Frame = -3 Query: 446 PFIGAALAAIYHVVVIRAIPFKSR 375 PFIGAALAA+YHVVVIRAIPFKSR Sbjct: 262 PFIGAALAALYHVVVIRAIPFKSR 285
>PIP12_ARATH (Q06611) Aquaporin PIP1.2 (Plasma membrane intrinsic protein 1b)| (PIP1b) (Transmembrane protein A) (TMP-A) (AthH2) Length = 286 Score = 48.9 bits (115), Expect = 6e-06 Identities = 22/24 (91%), Positives = 24/24 (100%) Frame = -3 Query: 446 PFIGAALAAIYHVVVIRAIPFKSR 375 PFIGAALAA+YHV+VIRAIPFKSR Sbjct: 262 PFIGAALAALYHVIVIRAIPFKSR 285
>PIP12_ORYSA (Q7XSQ9) Probable aquaporin PIP1.2 (Plasma membrane intrinsic| protein 1.2) (OsPIP1.2) Length = 282 Score = 47.8 bits (112), Expect = 1e-05 Identities = 23/24 (95%), Positives = 23/24 (95%) Frame = -3 Query: 446 PFIGAALAAIYHVVVIRAIPFKSR 375 PFIGAALAAIYH VVIRAIPFKSR Sbjct: 258 PFIGAALAAIYHQVVIRAIPFKSR 281
>PIP11_ORYSA (Q6EU94) Aquaporin PIP1.1 (Plasma membrane intrinsic protein 1a)| (PIP1a) (OsPIP1.1) (Water channel protein RWC1) (RWC-1) Length = 289 Score = 47.0 bits (110), Expect = 2e-05 Identities = 21/24 (87%), Positives = 23/24 (95%) Frame = -3 Query: 446 PFIGAALAAIYHVVVIRAIPFKSR 375 PF+GAALAAIYH V+IRAIPFKSR Sbjct: 265 PFVGAALAAIYHQVIIRAIPFKSR 288
>PIP2_PEA (P25794) Probable aquaporin PIP-type 7a (Turgor-responsive protein| 7a) (Turgor-responsive protein 31) Length = 289 Score = 45.8 bits (107), Expect = 5e-05 Identities = 21/24 (87%), Positives = 23/24 (95%) Frame = -3 Query: 446 PFIGAALAAIYHVVVIRAIPFKSR 375 PFIGAALAA+YH VVIRAIPFKS+ Sbjct: 266 PFIGAALAALYHQVVIRAIPFKSK 289
>PIP13_ARATH (Q08733) Aquaporin PIP1.3 (Plasma membrane intrinsic protein 1c)| (PIP1c) (Transmembrane protein B) (TMP-B) Length = 286 Score = 45.8 bits (107), Expect = 5e-05 Identities = 21/24 (87%), Positives = 23/24 (95%) Frame = -3 Query: 446 PFIGAALAAIYHVVVIRAIPFKSR 375 PFIGAALAA+YH +VIRAIPFKSR Sbjct: 262 PFIGAALAALYHQLVIRAIPFKSR 285
>PIP15_ARATH (Q8LAA6) Probable aquaporin PIP1.5 (Plasma membrane intrinsic| protein 1d) (PIP1d) Length = 287 Score = 45.4 bits (106), Expect = 6e-05 Identities = 20/24 (83%), Positives = 23/24 (95%) Frame = -3 Query: 446 PFIGAALAAIYHVVVIRAIPFKSR 375 PFIGAALAA+YH +VIRAIPFKS+ Sbjct: 263 PFIGAALAALYHQIVIRAIPFKSK 286
>PIP14_ARATH (Q39196) Probable aquaporin PIP1.4 (Plasma membrane intrinsic| protein 1.4) (Transmembrane protein C) (TMP-C) Length = 287 Score = 45.4 bits (106), Expect = 6e-05 Identities = 20/24 (83%), Positives = 23/24 (95%) Frame = -3 Query: 446 PFIGAALAAIYHVVVIRAIPFKSR 375 PFIGAALAA+YH +VIRAIPFKS+ Sbjct: 263 PFIGAALAALYHQIVIRAIPFKSK 286
>PIP1_LYCES (Q08451) Probable aquaporin PIP-type pTOM75 (Ripening-associated| membrane protein) (RAMP) Length = 286 Score = 38.1 bits (87), Expect = 0.010 Identities = 16/21 (76%), Positives = 19/21 (90%) Frame = -3 Query: 446 PFIGAALAAIYHVVVIRAIPF 384 P IGAALAAIYH ++IRA+PF Sbjct: 263 PMIGAALAAIYHQIIIRAMPF 283
>LAS17_YEAST (Q12446) Proline-rich protein LAS17| Length = 633 Score = 36.6 bits (83), Expect = 0.029 Identities = 18/57 (31%), Positives = 28/57 (49%), Gaps = 3/57 (5%) Frame = +2 Query: 188 RRCRQAHTPRRDGRFENY---YSVRGRDTIHVRAHQQPPPPPHDRSTMNSDKIPSMA 349 ++ + H PR + +N Y+ DTI H+ PPPPP T +SD+ S + Sbjct: 148 QKSQVVHGPRGESLIDNQRKRYNYEDVDTIPTTKHKAPPPPPPTAETFDSDQTSSFS 204
>PIP22_ARATH (P43287) Aquaporin PIP2.2 (Plasma membrane intrinsic protein 2b)| (PIP2b) (TMP2b) Length = 285 Score = 33.5 bits (75), Expect = 0.25 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = -3 Query: 446 PFIGAALAAIYHVVVIRAIPFKSRG 372 PFIGAA+AA YH V+RA KS G Sbjct: 253 PFIGAAIAAFYHQFVLRASGSKSLG 277
>PIP21_ARATH (P43286) Aquaporin PIP2.1 (Plasma membrane intrinsic protein 2a)| (PIP2a) Length = 287 Score = 33.5 bits (75), Expect = 0.25 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = -3 Query: 446 PFIGAALAAIYHVVVIRAIPFKSRG 372 PFIGAA+AA YH V+RA KS G Sbjct: 255 PFIGAAIAAFYHQFVLRASGSKSLG 279
>PIP25_ORYSA (Q8GRI8) Aquaporin PIP2.5 (Plasma membrane intrinsic protein 2.5)| (OsPIP2.5) Length = 283 Score = 33.1 bits (74), Expect = 0.32 Identities = 13/18 (72%), Positives = 17/18 (94%) Frame = -3 Query: 446 PFIGAALAAIYHVVVIRA 393 PFIGAA+AA+YH +V+RA Sbjct: 254 PFIGAAIAALYHQIVLRA 271
>PIP24_ORYSA (Q8GRT8) Aquaporin PIP2.4 (Plasma membrane intrinsic protein 2.4)| (OsPIP2.4) Length = 286 Score = 33.1 bits (74), Expect = 0.32 Identities = 13/18 (72%), Positives = 17/18 (94%) Frame = -3 Query: 446 PFIGAALAAIYHVVVIRA 393 PFIGAA+AA+YH V++RA Sbjct: 257 PFIGAAIAALYHQVILRA 274
>PIP26_ARATH (Q9ZV07) Probable aquaporin PIP2.6 (Plasma membrane intrinsic| protein 2e) (PIP2e) Length = 289 Score = 32.3 bits (72), Expect = 0.55 Identities = 14/25 (56%), Positives = 18/25 (72%) Frame = -3 Query: 446 PFIGAALAAIYHVVVIRAIPFKSRG 372 PF+GAA+AA YH V+RA K+ G Sbjct: 254 PFVGAAIAAFYHQFVLRAGAMKAYG 278
>PIP21_ORYSA (Q8H5N9) Probable aquaporin PIP2.1 (Plasma membrane intrinsic| protein 2a) (PIP2a) (OsPIP2.1) Length = 290 Score = 32.0 bits (71), Expect = 0.71 Identities = 13/25 (52%), Positives = 18/25 (72%) Frame = -3 Query: 446 PFIGAALAAIYHVVVIRAIPFKSRG 372 PF+GAA+AA YH ++RA K+ G Sbjct: 260 PFVGAAIAAFYHQYILRAGAIKALG 284
>PIP23_ARATH (P30302) Aquaporin PIP2.3 (Plasma membrane intrinsic protein 2c)| (PIP2c) (TMP2C) (RD28-PIP) (Water stress-induced tonoplast intrinsic protein) (WSI-TIP) Length = 285 Score = 32.0 bits (71), Expect = 0.71 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = -3 Query: 446 PFIGAALAAIYHVVVIRAIPFKSRG 372 PFIGA +AA YH V+RA KS G Sbjct: 253 PFIGATIAAFYHQFVLRASGSKSLG 277
>INADL_MOUSE (Q63ZW7) InaD-like protein (Inadl protein) (Pals1-associated tight| junction protein) (Protein associated to tight junctions) (Channel-interacting PDZ domain-containing protein) Length = 1834 Score = 31.6 bits (70), Expect = 0.93 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +2 Query: 269 HVRAHQQPPPPPHDRSTMNSDKIPSMAAQTDW 364 H+RA + PPPPH R + + + A T W Sbjct: 882 HLRAMESNPPPPHIREAAPASPVLELQAGTQW 913
>PIP25_ARATH (Q9SV31) Probable aquaporin PIP2.5 (Plasma membrane intrinsic| protein 2d) (PIP2d) Length = 286 Score = 31.6 bits (70), Expect = 0.93 Identities = 15/30 (50%), Positives = 20/30 (66%) Frame = -3 Query: 446 PFIGAALAAIYHVVVIRAIPFKSRG*WTNQ 357 PF GAA+AA YH V+RA K+ G + +Q Sbjct: 254 PFAGAAIAAFYHQFVLRAGAIKALGSFRSQ 283
>PIP26_ORYSA (Q7XLR1) Probable aquaporin PIP2.6 (Plasma membrane intrinsic| protein 2.6) (OsPIP2.6) Length = 282 Score = 30.0 bits (66), Expect = 2.7 Identities = 13/25 (52%), Positives = 16/25 (64%) Frame = -3 Query: 446 PFIGAALAAIYHVVVIRAIPFKSRG 372 PFIGA AA YH ++RA K+ G Sbjct: 250 PFIGALAAAAYHQYILRAAAIKALG 274
>PIP1_ATRCA (P42767) Aquaporin PIP-type| Length = 282 Score = 30.0 bits (66), Expect = 2.7 Identities = 13/25 (52%), Positives = 16/25 (64%) Frame = -3 Query: 446 PFIGAALAAIYHVVVIRAIPFKSRG 372 PF+GA AA YH V+RA K+ G Sbjct: 250 PFVGALAAAAYHQYVLRAAAIKALG 274
>PIP24_ARATH (Q9FF53) Probable aquaporin PIP2.4 (Plasma membrane intrinsic| protein 2.4) Length = 291 Score = 30.0 bits (66), Expect = 2.7 Identities = 13/25 (52%), Positives = 16/25 (64%) Frame = -3 Query: 446 PFIGAALAAIYHVVVIRAIPFKSRG 372 P IGAA AA YH ++RA K+ G Sbjct: 255 PMIGAAAAAFYHQFILRAAAIKALG 279
>RS5_HALSA (Q9HPB4) 30S ribosomal protein S5P| Length = 212 Score = 29.6 bits (65), Expect = 3.5 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = -2 Query: 420 DLPRGGDQGDPLQEPRLVDQSVWAAMDGILSLFIVDRSCGGG 295 D+ D G PL+EP +VDQ + D +L + +V R G Sbjct: 24 DMSEALDTGLPLKEPEIVDQLLPGLDDEVLDINMVQRMTDSG 65
>PIP27_ARATH (P93004) Aquaporin PIP2.7 (Plasma membrane intrinsic protein 3)| (Salt stress-induced major intrinsic protein) Length = 280 Score = 28.9 bits (63), Expect = 6.0 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -3 Query: 446 PFIGAALAAIYHVVVIRAIPFKSRG 372 PF+GA AA YH ++RA K+ G Sbjct: 248 PFLGALAAAAYHQYILRASAIKALG 272
>RL4_HALMA (P12735) 50S ribosomal protein L4P (Hmal4) (Hl6)| Length = 246 Score = 28.5 bits (62), Expect = 7.9 Identities = 20/54 (37%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = +2 Query: 200 QAHTPRRDGRFENY-YSVRGRDTIHVRAHQQPPPPPHDRSTMNSDKIPSMAAQT 358 QAH P++DGR +V+GR AH PP DRS +DK +A ++ Sbjct: 67 QAHVPKQDGRARRVPQAVKGRS-----AH--PPKTEKDRSLDLNDKERQLAVRS 113
>NONO_PONPY (Q5RFL9) Non-POU domain-containing octamer-binding protein (NonO| protein) Length = 471 Score = 28.5 bits (62), Expect = 7.9 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +2 Query: 197 RQAHTPRRDGRFENYYSVRGRDTIHVRAHQQPPPPP 304 +Q HTPR+ ++ + H + QQPPPPP Sbjct: 11 KQNHTPRK------HHQHHHQQQHHQQQQQQPPPPP 40
>NONO_HUMAN (Q15233) Non-POU domain-containing octamer-binding protein (NonO| protein) (54 kDa nuclear RNA- and DNA-binding protein) (p54(nrb)) (p54nrb) (55 kDa nuclear protein) (NMT55) (DNA-binding p52/p100 complex, 52 kDa subunit) Length = 471 Score = 28.5 bits (62), Expect = 7.9 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +2 Query: 197 RQAHTPRRDGRFENYYSVRGRDTIHVRAHQQPPPPP 304 +Q HTPR+ ++ + H + QQPPPPP Sbjct: 11 KQNHTPRK------HHQHHHQQQHHQQQQQQPPPPP 40 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 59,604,966 Number of Sequences: 219361 Number of extensions: 1240386 Number of successful extensions: 5644 Number of sequences better than 10.0: 29 Number of HSP's better than 10.0 without gapping: 4390 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5168 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2677159704 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
