ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbart22a03 |
|---|---|
| Clone Library Name | barley_pub |
>SPT_ARATH (Q9FUA4) Protein SPATULA| Length = 373 Score = 36.2 bits (82), Expect = 0.049 Identities = 18/40 (45%), Positives = 27/40 (67%) Frame = -2 Query: 445 LQDLVPNMDKQTNTSDMLDIAVDYIKVLQDQIEKLKQDQG 326 LQ L+PN +K T+ + MLD A++Y+K LQ Q++ L G Sbjct: 220 LQSLIPNSNK-TDKASMLDEAIEYLKQLQLQVQMLTMRNG 258
>PIF4_ARATH (Q8W2F3) Phytochrome-interacting factor 4 (Basic helix-loop-helix| protein 9) (bHLH9) (AtbHLH009) (Short under red-light 2) Length = 430 Score = 34.3 bits (77), Expect = 0.19 Identities = 17/46 (36%), Positives = 30/46 (65%) Frame = -2 Query: 445 LQDLVPNMDKQTNTSDMLDIAVDYIKVLQDQIEKLKQDQGNCSCSA 308 LQ+L+P+ K T+ + +LD A+DY+K LQ Q++ + G + +A Sbjct: 280 LQELIPHCSK-TDKASILDEAIDYLKSLQLQLQVMWMGSGMAAAAA 324
>SRBP1_MOUSE (Q9WTN3) Sterol regulatory element-binding protein 1 (SREBP-1)| (Sterol regulatory element-binding transcription factor 1) Length = 1134 Score = 34.3 bits (77), Expect = 0.19 Identities = 17/38 (44%), Positives = 25/38 (65%) Frame = -2 Query: 445 LQDLVPNMDKQTNTSDMLDIAVDYIKVLQDQIEKLKQD 332 L+DLV + + N S +L A+DYI+ LQ +KLKQ+ Sbjct: 340 LKDLVVGTEAKLNKSAVLRKAIDYIRFLQHSNQKLKQE 377
>SRBP1_HUMAN (P36956) Sterol regulatory element-binding protein 1 (SREBP-1)| (Sterol regulatory element-binding transcription factor 1) Length = 1147 Score = 34.3 bits (77), Expect = 0.19 Identities = 17/38 (44%), Positives = 25/38 (65%) Frame = -2 Query: 445 LQDLVPNMDKQTNTSDMLDIAVDYIKVLQDQIEKLKQD 332 L+DLV + + N S +L A+DYI+ LQ +KLKQ+ Sbjct: 346 LKDLVVGTEAKLNKSAVLRKAIDYIRFLQHSNQKLKQE 383
>SRBP1_RAT (P56720) Sterol regulatory element-binding protein 1 (SREBP-1)| (Sterol regulatory element-binding transcription factor 1) (Adipocyte determination- and differentiation-dependent factor 1) (ADD1) (Fragment) Length = 1024 Score = 34.3 bits (77), Expect = 0.19 Identities = 17/38 (44%), Positives = 25/38 (65%) Frame = -2 Query: 445 LQDLVPNMDKQTNTSDMLDIAVDYIKVLQDQIEKLKQD 332 L+DLV + + N S +L A+DYI+ LQ +KLKQ+ Sbjct: 316 LKDLVVGTEAKLNKSAVLRKAIDYIRFLQHSNQKLKQE 353
>SRBP1_CRIGR (Q60416) Sterol regulatory element-binding protein 1 (SREBP-1)| (Sterol regulatory element-binding transcription factor 1) Length = 1133 Score = 34.3 bits (77), Expect = 0.19 Identities = 17/38 (44%), Positives = 25/38 (65%) Frame = -2 Query: 445 LQDLVPNMDKQTNTSDMLDIAVDYIKVLQDQIEKLKQD 332 L+DLV + + N S +L A+DYI+ LQ +KLKQ+ Sbjct: 340 LKDLVVGTEAKLNKSAVLRKAIDYIRFLQHSNQKLKQE 377
>PIF3_ARATH (O80536) Phytochrome-interacting factor 3 (Phytochrome-associated| protein 3) (Basic helix-loop-helix protein 8) (bHLH8) (AtbHLH008) Length = 524 Score = 33.9 bits (76), Expect = 0.24 Identities = 17/40 (42%), Positives = 26/40 (65%) Frame = -2 Query: 445 LQDLVPNMDKQTNTSDMLDIAVDYIKVLQDQIEKLKQDQG 326 LQ+L+PN +K S MLD A++Y+K LQ Q++ + G Sbjct: 366 LQELIPNCNKVDKAS-MLDEAIEYLKSLQLQVQIMSMASG 404
>BIM2_ARATH (Q9CAA4) Putative transcription factor BIM2 (BES1-interacting| Myc-like protein 2) (Transcription factor EN 125) (AtbHLH 102) Length = 311 Score = 33.1 bits (74), Expect = 0.41 Identities = 11/34 (32%), Positives = 26/34 (76%) Frame = -2 Query: 445 LQDLVPNMDKQTNTSDMLDIAVDYIKVLQDQIEK 344 L++L+PN +++ +T+ L +DY++ LQ++++K Sbjct: 68 LRELIPNSEQKRDTASFLLEVIDYVQYLQEKVQK 101
>SRBP2_CRIGR (Q60429) Sterol regulatory element-binding protein 2 (SREBP-2)| (Sterol regulatory element-binding transcription factor 2) Length = 1139 Score = 33.1 bits (74), Expect = 0.41 Identities = 17/38 (44%), Positives = 24/38 (63%) Frame = -2 Query: 445 LQDLVPNMDKQTNTSDMLDIAVDYIKVLQDQIEKLKQD 332 L+DLV D + + S +L A+DYIK LQ KL+Q+ Sbjct: 351 LKDLVMGTDAKMHKSGVLRKAIDYIKYLQQVNHKLRQE 388
>SRBP2_HUMAN (Q12772) Sterol regulatory element-binding protein 2 (SREBP-2)| (Sterol regulatory element-binding transcription factor 2) Length = 1141 Score = 33.1 bits (74), Expect = 0.41 Identities = 17/38 (44%), Positives = 24/38 (63%) Frame = -2 Query: 445 LQDLVPNMDKQTNTSDMLDIAVDYIKVLQDQIEKLKQD 332 L+DLV D + + S +L A+DYIK LQ KL+Q+ Sbjct: 353 LKDLVMGTDAKMHKSGVLRKAIDYIKYLQQVNHKLRQE 390
>MINE_PSEAE (Q9HYZ5) Cell division topological specificity factor| Length = 84 Score = 30.8 bits (68), Expect = 2.1 Identities = 14/41 (34%), Positives = 25/41 (60%) Frame = -2 Query: 439 DLVPNMDKQTNTSDMLDIAVDYIKVLQDQIEKLKQDQGNCS 317 D +P + K D+L++ Y+ + Q+QI+ ++QGNCS Sbjct: 38 DYLPQLQK-----DLLEVIRKYVPIDQEQIQVELENQGNCS 73
>VMSA_HBVW2 (P03141) Major surface antigen precursor| Length = 399 Score = 30.4 bits (67), Expect = 2.7 Identities = 22/60 (36%), Positives = 29/60 (48%), Gaps = 11/60 (18%) Frame = +1 Query: 211 NPRKQNLVLPI------TLVQSTNITSHIWFCGVSTSDRLSR-----SSFLGPVLVSQFG 357 +PR + L LP T+ + NI SHI T D ++ S FLGP+LV Q G Sbjct: 132 DPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAG 191
>VMSA_HBVAW (P03142) Major surface antigen precursor| Length = 388 Score = 30.0 bits (66), Expect = 3.5 Identities = 22/60 (36%), Positives = 29/60 (48%), Gaps = 11/60 (18%) Frame = +1 Query: 211 NPRKQNLVLPI------TLVQSTNITSHIWFCGVSTSDRLS-----RSSFLGPVLVSQFG 357 +PR + L LP T+ + NI SHI T D ++ S FLGP+LV Q G Sbjct: 121 DPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTIMENITSGFLGPLLVLQAG 180
>YKL4_CAEEL (P42171) Hypothetical protein C03C10.4| Length = 244 Score = 29.6 bits (65), Expect = 4.6 Identities = 15/55 (27%), Positives = 28/55 (50%) Frame = -2 Query: 442 QDLVPNMDKQTNTSDMLDIAVDYIKVLQDQIEKLKQDQGNCSCSADQKC*RHRTR 278 ++ V + N + LD Y+ V++ Q+E +K+ +G C + +KC R R Sbjct: 99 REQVQILHNSLNNNQELDAEKQYVDVIEQQLELVKEAEGECLKA--EKCHASRVR 151
>MPH23_YEAST (P47186) Alpha-glucosides permease MPH2/3 (Maltose transport| protein 2/3) Length = 602 Score = 29.6 bits (65), Expect = 4.6 Identities = 16/45 (35%), Positives = 25/45 (55%) Frame = -2 Query: 397 MLDIAVDYIKVLQDQIEKLKQDQGNCSCSADQKC*RHRTRYARLC 263 ++ + VD IKV D+ ++L +G+ S + K R RTR LC Sbjct: 324 LVTLEVDKIKVTIDKEKRLTSKEGSYSDCFEDKINRRRTRITCLC 368
>CRD1_CHLRE (Q9LD46) Magnesium-protoporphyrin IX monomethyl ester [oxidative]| cyclase 1, chloroplast precursor (EC 1.14.13.81) (Mg-protoporphyrin IX monomethyl ester oxidative cyclase 1) (Copper response defect 1 protein) (Copper-response target 1 protein Length = 407 Score = 29.3 bits (64), Expect = 6.0 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = +1 Query: 124 KPLKLIHSTTKEGEDGHGDYLTCERHLQLNPRKQ 225 KP +I++T + G+ Y+T RHLQ NP Q Sbjct: 206 KPKFIIYATFLSEKIGYWRYITIYRHLQRNPDNQ 239
>XYLA_RUMFL (Q9S306) Xylose isomerase (EC 5.3.1.5)| Length = 438 Score = 29.3 bits (64), Expect = 6.0 Identities = 17/43 (39%), Positives = 21/43 (48%) Frame = -2 Query: 442 QDLVPNMDKQTNTSDMLDIAVDYIKVLQDQIEKLKQDQGNCSC 314 +DL P T+D LDI DYIK + Q +K K G C Sbjct: 101 RDLSPEYGSLKATNDQLDIVTDYIK--EKQGDKFKCLWGTAKC 141
>BIM1_ARATH (Q9LEZ3) Transcription factor BIM1 (BES1-interacting Myc-like| protein 1) (Transcription factor EN 126) (AtbHLH 46) Length = 530 Score = 28.9 bits (63), Expect = 7.8 Identities = 11/34 (32%), Positives = 23/34 (67%) Frame = -2 Query: 445 LQDLVPNMDKQTNTSDMLDIAVDYIKVLQDQIEK 344 L+ L+PN D++ + + L ++YI+ LQ++ +K Sbjct: 299 LRQLIPNSDQKRDKASFLLEVIEYIQFLQEKADK 332 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 67,292,343 Number of Sequences: 219361 Number of extensions: 1275386 Number of successful extensions: 2832 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 2790 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2832 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3465624120 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
