| Clone Name | rbart21g04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RP541_RHIME (P17263) RNA polymerase sigma-54 factor | 29 | 6.6 | 2 | CBX4_HUMAN (O00257) Chromobox protein homolog 4 (Polycomb 2 homo... | 29 | 6.6 |
|---|
>RP541_RHIME (P17263) RNA polymerase sigma-54 factor| Length = 514 Score = 29.3 bits (64), Expect = 6.6 Identities = 18/46 (39%), Positives = 24/46 (52%), Gaps = 3/46 (6%) Frame = -2 Query: 424 LVLVQFSAQEEERHGEASKQPSVDPT---RKVFGEMPGELGGRPDQ 296 L L F AQE E++ QP+ +PT R+ G P E GG D+ Sbjct: 33 LELSHFIAQEVEKNPLLEVQPADEPTISDREDAGPHPAETGGETDE 78
>CBX4_HUMAN (O00257) Chromobox protein homolog 4 (Polycomb 2 homolog) (Pc2)| (hPc2) Length = 558 Score = 29.3 bits (64), Expect = 6.6 Identities = 15/40 (37%), Positives = 22/40 (55%), Gaps = 6/40 (15%) Frame = -2 Query: 400 QEEERHGEASKQPS------VDPTRKVFGEMPGELGGRPD 299 +EEE G + QP + PT++ FGE P +L +PD Sbjct: 326 REEEVSGVSDPQPQDAGSRKLSPTKEAFGEQPLQLTTKPD 365 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 56,382,924 Number of Sequences: 219361 Number of extensions: 975596 Number of successful extensions: 2215 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2156 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2215 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3812186532 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)