Clone Name | rbart21g02 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | AT11C_HUMAN (Q8NB49) Probable phospholipid-transporting ATPase I... | 30 | 2.4 | 2 | SRCH_HUMAN (P23327) Sarcoplasmic reticulum histidine-rich calciu... | 30 | 3.1 | 3 | AT11C_MOUSE (Q9QZW0) Probable phospholipid-transporting ATPase 1... | 30 | 4.1 | 4 | MYO5C_HUMAN (Q9NQX4) Myosin-5C (Myosin Vc) | 28 | 9.1 |
---|
>AT11C_HUMAN (Q8NB49) Probable phospholipid-transporting ATPase IG (EC 3.6.3.1)| (ATPase class I type 11C) (ATPase IG) (ATPase IQ) (ATPase class VI type 11C) Length = 1132 Score = 30.4 bits (67), Expect = 2.4 Identities = 10/29 (34%), Positives = 20/29 (68%) Frame = -1 Query: 106 YFFFLRIPRYITTWVYVLLCLFVSLFARV 20 YF F ++ ++TW+ ++L +F+SLF + Sbjct: 1057 YFVFAQMLSSVSTWLAIILLIFISLFPEI 1085
>SRCH_HUMAN (P23327) Sarcoplasmic reticulum histidine-rich calcium-binding| protein precursor Length = 699 Score = 30.0 bits (66), Expect = 3.1 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = -2 Query: 468 EEGEEDXHRQDKDEGLKMKLFRRFHHHHAHDSENEVD 358 +EGEE+ ++++E + + H H H SE + D Sbjct: 190 DEGEEEEEEEEEEEEASTEYGHQAHRHRGHGSEEDED 226
>AT11C_MOUSE (Q9QZW0) Probable phospholipid-transporting ATPase 11C (EC 3.6.3.1)| (Fragment) Length = 347 Score = 29.6 bits (65), Expect = 4.1 Identities = 10/29 (34%), Positives = 20/29 (68%) Frame = -1 Query: 106 YFFFLRIPRYITTWVYVLLCLFVSLFARV 20 YF F ++ ++TW+ ++L +F+SLF + Sbjct: 285 YFVFAQMLCSVSTWLAIILLIFISLFPEI 313
>MYO5C_HUMAN (Q9NQX4) Myosin-5C (Myosin Vc)| Length = 1742 Score = 28.5 bits (62), Expect = 9.1 Identities = 11/42 (26%), Positives = 21/42 (50%) Frame = -2 Query: 468 EEGEEDXHRQDKDEGLKMKLFRRFHHHHAHDSENEVDEVEEL 343 EE HR ++EG + K + H + E +D+++E+ Sbjct: 1244 EELSNQLHRSQEEEGTQRKALEAQNEIHTKEKEKLIDKIQEM 1285 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 50,976,503 Number of Sequences: 219361 Number of extensions: 838522 Number of successful extensions: 3045 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2634 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2980 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3072927439 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)