Clone Name | rbart21f12 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | ZC3H5_MOUSE (Q8BL48) Zinc finger CCCH-type domain-containing pro... | 28 | 7.1 | 2 | ZC3H5_HUMAN (Q9C0B0) Zinc finger CCCH-type domain-containing pro... | 28 | 7.1 | 3 | ZC3H5_CANFA (Q6EE22) Zinc finger CCCH-type domain-containing pro... | 28 | 7.1 | 4 | TBX6_BRARE (P79742) T-box transcription factor TBX6 (T-box prote... | 28 | 9.2 |
---|
>ZC3H5_MOUSE (Q8BL48) Zinc finger CCCH-type domain-containing protein 5| Length = 810 Score = 28.5 bits (62), Expect = 7.1 Identities = 15/50 (30%), Positives = 21/50 (42%) Frame = +1 Query: 169 TNKTKWPPRPCRRGHICSIYSEQHENDDTNHGNKNPDDRLQPSSPIQAPD 318 T K PPR CR+G+ C Y H + D + R P ++ D Sbjct: 218 TEPCKKPPRLCRQGYACPYY---HNSKDRRRSPRKHKYRSSPCPNVKHGD 264
>ZC3H5_HUMAN (Q9C0B0) Zinc finger CCCH-type domain-containing protein 5| Length = 810 Score = 28.5 bits (62), Expect = 7.1 Identities = 15/50 (30%), Positives = 21/50 (42%) Frame = +1 Query: 169 TNKTKWPPRPCRRGHICSIYSEQHENDDTNHGNKNPDDRLQPSSPIQAPD 318 T K PPR CR+G+ C Y H + D + R P ++ D Sbjct: 218 TEPCKKPPRLCRQGYACPYY---HNSKDRRRSPRKHKYRSSPCPNVKHGD 264
>ZC3H5_CANFA (Q6EE22) Zinc finger CCCH-type domain-containing protein 5| Length = 810 Score = 28.5 bits (62), Expect = 7.1 Identities = 15/50 (30%), Positives = 21/50 (42%) Frame = +1 Query: 169 TNKTKWPPRPCRRGHICSIYSEQHENDDTNHGNKNPDDRLQPSSPIQAPD 318 T K PPR CR+G+ C Y H + D + R P ++ D Sbjct: 218 TEPCKKPPRLCRQGYACPYY---HNSKDRRRSPRKHKYRSSPCPNVKHGD 264
>TBX6_BRARE (P79742) T-box transcription factor TBX6 (T-box protein 6)| Length = 473 Score = 28.1 bits (61), Expect = 9.2 Identities = 21/72 (29%), Positives = 28/72 (38%), Gaps = 11/72 (15%) Frame = +1 Query: 145 QSHRNLRLTNKTKWPPRPCRRGHICSIY----------SEQHENDDTNHGNKNPDDRLQP 294 Q+H L L+N+ PR +C+ S N H N P +LQP Sbjct: 301 QTHTLLSLSNRHFSSPRESNLNSVCAALPVSQLSTGHTSFSRLNPQETHHNSRPKIQLQP 360 Query: 295 SSP-IQAPDTDV 327 P +Q D DV Sbjct: 361 PHPSLQCHDLDV 372 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,866,270 Number of Sequences: 219361 Number of extensions: 854016 Number of successful extensions: 2226 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2192 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2226 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2395157885 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)