| Clone Name | rbart21f07 |
|---|---|
| Clone Library Name | barley_pub |
>TIP11_ORYSA (P50156) Probable aquaporin TIP1.1 (Tonoplast intrinsic protein| 1.1) (OsTIP1.1) (rTIP1) Length = 250 Score = 33.5 bits (75), Expect = 0.14 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 290 LFISRTHEQLPTTDY 246 LFIS THEQLPTTDY Sbjct: 236 LFISHTHEQLPTTDY 250
>TIP1_MEDTR (Q9FY14) Probable aquaporin TIP-type (MtAQP1)| Length = 250 Score = 32.0 bits (71), Expect = 0.41 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -1 Query: 290 LFISRTHEQLPTTDY 246 LFI+ THEQLPTTDY Sbjct: 236 LFINSTHEQLPTTDY 250
>TIP1_MEDSA (P42067) Probable aquaporin TIP-type (Membrane channel protein 1)| (MsMCP1) Length = 249 Score = 32.0 bits (71), Expect = 0.41 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -1 Query: 290 LFISRTHEQLPTTDY 246 LFI+ THEQLPTTDY Sbjct: 235 LFINSTHEQLPTTDY 249
>TIP11_ARATH (P25818) Aquaporin TIP1.1 (Tonoplast intrinsic protein 1.1)| (Gamma-tonoplast intrinsic protein) (Gamma-TIP) (Aquaporin-TIP) (Tonoplast intrinsic protein, root-specific RB7) Length = 251 Score = 30.4 bits (67), Expect = 1.2 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -1 Query: 287 FISRTHEQLPTTDY 246 FI+ THEQLPTTDY Sbjct: 238 FINTTHEQLPTTDY 251
>POLG_TMEVG (P08545) Genome polyprotein [Contains: Coat protein VP4 (P1A); Coat| protein VP2 (P1B); Coat protein VP3 (P1C); Coat protein VP1 (P1D); Picornain 2A (EC 3.4.22.29) (Core protein P2A); Core protein P2B; Core protein P2C; Core protein P3A; Genome Length = 2303 Score = 30.4 bits (67), Expect = 1.2 Identities = 20/55 (36%), Positives = 26/55 (47%), Gaps = 3/55 (5%) Frame = -2 Query: 226 PPPARPSVWSIASPLASSHESFKFALNE*IHPIPRVDRSISLWCCETF---DDRP 71 PPPA P+V PL ++E F FA N I + +SI W F +D P Sbjct: 1180 PPPACPNVMQPQGPLREANEGFTFAKN--IEWATKTIQSIVNWLTSWFKQEEDHP 1232
>POLG_TMEVB (P08544) Genome polyprotein [Contains: Coat protein VP4 (P1A); Coat| protein VP2 (P1B); Coat protein VP3 (P1C); Coat protein VP1 (P1D); Picornain 2A (EC 3.4.22.29) (Core protein P2A); Core protein P2B; Core protein P2C; Core protein P3A; Genome Length = 2303 Score = 29.6 bits (65), Expect = 2.1 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = -2 Query: 226 PPPARPSVWSIASPLASSHESFKFALN 146 PPPA P+V PL ++E F FA N Sbjct: 1180 PPPACPNVMQPQGPLREANEGFTFAKN 1206
>PGRC2_HUMAN (O15173) Membrane-associated progesterone receptor component 2| (Progesterone membrane-binding protein) (Steroid receptor protein DG6) Length = 223 Score = 29.3 bits (64), Expect = 2.7 Identities = 18/48 (37%), Positives = 27/48 (56%) Frame = +3 Query: 129 MGWIHSFKANLNDS*LEARGDAIDHTDGRAGGGQAAVNLIIGGGELLV 272 +G + S + ND E+ GDA +G G AA+ L+ GGGE+L+ Sbjct: 10 LGTLGSGSESSNDGGSESPGDAGAAAEG-GGWAAAALALLTGGGEMLL 56
>S26A1_MOUSE (P58735) Sulfate anion transporter 1 (SAT-1) (Solute carrier family| 26 member 1) Length = 704 Score = 28.9 bits (63), Expect = 3.5 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +2 Query: 35 GRIHRFYTSKLTGSIVKGFTAPQTDGP 115 G++H + S++ G+I GF APQ P Sbjct: 314 GQLHTRFDSRVAGNIPTGFVAPQVPDP 340
>RECK_MOUSE (Q9Z0J1) Reversion-inducing cysteine-rich protein with Kazal motifs| precursor (mRECK) Length = 971 Score = 28.5 bits (62), Expect = 4.6 Identities = 14/55 (25%), Positives = 24/55 (43%) Frame = -2 Query: 220 PARPSVWSIASPLASSHESFKFALNE*IHPIPRVDRSISLWCCETFDDRPCQFAC 56 P + ++ + AS +N P + + SL+CC+ +D CQ AC Sbjct: 175 PGPSQIKAVENYCASISPQLIHCVNNYTQSYPMRNPTDSLYCCDRAEDHACQNAC 229
>RECK_HUMAN (O95980) Reversion-inducing cysteine-rich protein with Kazal motifs| precursor (hRECK) (Suppressor of tumorigenicity 15) (ST15) Length = 971 Score = 28.5 bits (62), Expect = 4.6 Identities = 14/55 (25%), Positives = 24/55 (43%) Frame = -2 Query: 220 PARPSVWSIASPLASSHESFKFALNE*IHPIPRVDRSISLWCCETFDDRPCQFAC 56 P + ++ + AS +N P + + SL+CC+ +D CQ AC Sbjct: 175 PGPSQIKAVENYCASISPQLIHCVNNYTQSYPMRNPTDSLYCCDRAEDHACQNAC 229
>PAFA2_HUMAN (Q99487) Platelet-activating factor acetylhydrolase 2, cytoplasmic| (EC 3.1.1.47) (Serine-dependent phospholipase A2) (HSD-PLA2) Length = 392 Score = 28.5 bits (62), Expect = 4.6 Identities = 13/44 (29%), Positives = 26/44 (59%), Gaps = 2/44 (4%) Frame = +2 Query: 35 GRIHRFYT--SKLTGSIVKGFTAPQTDGPIDPGNGMDSFIQSKL 160 G +HR T + +TG+++ F + +T G +DP G + +++ L Sbjct: 311 GSVHRSQTDFAFVTGNLIGKFFSTETRGSLDPYEGQEVMVRAML 354
>POLG_TMEVD (P13899) Genome polyprotein [Contains: Coat protein VP4 (P1A); Coat| protein VP2 (P1B); Coat protein VP3 (P1C); Coat protein VP1 (P1D); Picornain 2A (EC 3.4.22.29) (Core protein P2A); Core protein P2B; Core protein P2C; Core protein P3A; Genome Length = 2301 Score = 28.1 bits (61), Expect = 6.0 Identities = 19/55 (34%), Positives = 25/55 (45%), Gaps = 3/55 (5%) Frame = -2 Query: 226 PPPARPSVWSIASPLASSHESFKFALNE*IHPIPRVDRSISLWCCETF---DDRP 71 PPP P+V PL ++E F FA N I + +SI W F +D P Sbjct: 1178 PPPVCPNVLQPQGPLREANEGFTFAKN--IEWAMKTIQSIVNWLTSWFKQEEDHP 1230
>ETS3_DROME (P29774) DNA-binding protein D-ETS-3| Length = 490 Score = 27.7 bits (60), Expect = 7.8 Identities = 21/68 (30%), Positives = 27/68 (39%) Frame = +3 Query: 78 SSKVSQHHKLMDRSTLGMGWIHSFKANLNDS*LEARGDAIDHTDGRAGGGQAAVNLIIGG 257 SS +H D+STL S A + S A DH GR G +++ GG Sbjct: 193 SSSHVEHKVRADKSTLDCATTSSHAAAPSSS-----SSASDHQQGRISGSKSSNTSGTGG 247 Query: 258 GELLVGAG 281 G G G Sbjct: 248 GASASGGG 255 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,310,438 Number of Sequences: 219361 Number of extensions: 713122 Number of successful extensions: 1910 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 1882 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1910 length of database: 80,573,946 effective HSP length: 72 effective length of database: 64,779,954 effective search space used: 1554718896 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)