Clone Name | rbart21e11 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | SPA4L_HUMAN (Q8TC36) Sperm-associated antigen 4-like protein (Te... | 30 | 3.3 | 2 | URE2_KLUMA (Q8NJR4) Protein URE2 | 28 | 9.7 |
---|
>SPA4L_HUMAN (Q8TC36) Sperm-associated antigen 4-like protein (Testis and| spermatogenesis-related gene 4 protein) Length = 379 Score = 29.6 bits (65), Expect = 3.3 Identities = 19/60 (31%), Positives = 30/60 (50%), Gaps = 4/60 (6%) Frame = -3 Query: 266 D*AFQQSQCMIDHISWFNDFRHAARSSARVHPVLHRSCRTIGIRSHMF----LLVACKFG 99 D A +QCM+ +SWF F + R+ A+ VL +CR + + +L+ C FG Sbjct: 57 DQALGLTQCMLGCVSWFTCFACSLRTQAQ--QVLFNTCRCKLLCQKLMEKTGILLLCAFG 114
>URE2_KLUMA (Q8NJR4) Protein URE2| Length = 404 Score = 28.1 bits (61), Expect = 9.7 Identities = 14/32 (43%), Positives = 17/32 (53%) Frame = -2 Query: 366 HHHQQIRNQPNRSGSKGETTIRASMLHHGRNS 271 HHHQQ + PN + G T + ML G NS Sbjct: 117 HHHQQRQQHPNNNVQAG--TSQQQMLFQGANS 146 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 64,613,263 Number of Sequences: 219361 Number of extensions: 1286544 Number of successful extensions: 2584 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2541 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2582 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2511994855 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)