| Clone Name | rbart21d12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YTRE_LEPBI (P20464) Hypothetical 22 kDa protein in trpE 5'region | 29 | 5.3 | 2 | PSK4_ARATH (Q9SZG4) Putative phytosulfokines 4 precursor (AtPSK4... | 28 | 9.1 |
|---|
>YTRE_LEPBI (P20464) Hypothetical 22 kDa protein in trpE 5'region| Length = 189 Score = 29.3 bits (64), Expect = 5.3 Identities = 13/51 (25%), Positives = 24/51 (47%), Gaps = 6/51 (11%) Frame = +3 Query: 45 YINPSGNVTWNTKEKK*EMAE------HYTSRITHSTGNRLTKVIKRPNQP 179 ++NPSG+ +WN +K + + H+T + G + +P QP Sbjct: 135 HLNPSGDRSWNINSQKASICKGCPSSAHFTETLEFHYGKHHQTYVTKPQQP 185
>PSK4_ARATH (Q9SZG4) Putative phytosulfokines 4 precursor (AtPSK4) [Contains:| Phytosulfokine-alpha-like (PSK-alpha-like) (Phytosulfokine-a-like); Phytosulfokine-beta (PSK-beta) (Phytosulfokine-b)] Length = 87 Score = 28.5 bits (62), Expect = 9.1 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = -2 Query: 147 ICSLYCV*CVTCSALPFPTFFPSYST 70 I L C +TCSA P P +F S++T Sbjct: 10 IALLLCATMLTCSARPEPAYFASFTT 35 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,154,251 Number of Sequences: 219361 Number of extensions: 788546 Number of successful extensions: 2797 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2411 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2733 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3072927439 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)