Clone Name | rbart21d05 |
---|---|
Clone Library Name | barley_pub |
>R1AB_CVPPU (Q9IW06) Replicase polyprotein 1ab (pp1ab) (ORF1ab polyprotein)| [Includes: Replicase polyprotein 1a (pp1a) (ORF1a)] [Contains: p9; p87; p195 (EC 3.4.22.-) (Papain-like proteinases 1/2) (PL1-PRO/PL2-PRO); Peptide HD2; Unknown protein 1; 3C-like Length = 6684 Score = 33.1 bits (74), Expect = 0.29 Identities = 17/40 (42%), Positives = 21/40 (52%), Gaps = 4/40 (10%) Frame = -1 Query: 405 KAVVDGGACKCEAYFHDYDIMEDFQH----GDPNSDPRWN 298 K+ V G + C+A YD + DFQH D SDP WN Sbjct: 1935 KSAVCGNSILCKACLASYDELADFQHLQVTWDFKSDPLWN 1974
>FYB_MOUSE (O35601) FYN-binding protein (FYN-T-binding protein) (FYB-120/130)| (p120/p130) (SLP-76-associated phosphoprotein) (SLAP-130) Length = 819 Score = 32.3 bits (72), Expect = 0.50 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = +3 Query: 78 QPPTDLKEPINDPNRTHIVHEHG 146 +PP DLK PIND N+ ++H G Sbjct: 413 KPPLDLKHPINDENQDGVMHSDG 435
>FYB_HUMAN (O15117) FYN-binding protein (FYN-T-binding protein) (FYB-120/130)| (p120/p130) (SLP-76-associated phosphoprotein) (SLAP-130) Length = 783 Score = 29.6 bits (65), Expect = 3.2 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +3 Query: 78 QPPTDLKEPINDPNRTHIVHEHG 146 +PP DLK P+N+ N+ + H G Sbjct: 425 KPPFDLKSPVNEDNQDGVTHSDG 447
>LTB1S_HUMAN (P22064) Latent transforming growth factor beta-binding protein,| isoform 1S precursor (LTBP-1) (Transforming growth factor beta-1-binding protein 1) (TGF-beta1-BP-1) Length = 1394 Score = 28.5 bits (62), Expect = 7.2 Identities = 16/44 (36%), Positives = 22/44 (50%) Frame = +1 Query: 169 SISHPPKVC*NLHDCCLQNTACPSHSRVVLLIFCNNAHDLVRCV 300 SIS + C ++ D C+ NT C SH FC+N RC+ Sbjct: 907 SISADGRTCEDI-DECVNNTVCDSHG------FCDNTAGSFRCL 943
>LTB1S_MOUSE (Q8CG18) Latent transforming growth factor beta-binding protein,| isoform 1S precursor (LTBP-1) (Transforming growth factor beta-1-binding protein 1) (TGF-beta1-BP-1) Length = 1389 Score = 28.5 bits (62), Expect = 7.2 Identities = 16/44 (36%), Positives = 22/44 (50%) Frame = +1 Query: 169 SISHPPKVC*NLHDCCLQNTACPSHSRVVLLIFCNNAHDLVRCV 300 SIS + C ++ D C+ NT C SH FC+N RC+ Sbjct: 903 SISADGRTCEDI-DECVNNTVCDSHG------FCDNTAGSFRCL 939
>SYA_STRCO (Q9KXP9) Alanyl-tRNA synthetase (EC 6.1.1.7) (Alanine--tRNA ligase)| (AlaRS) Length = 890 Score = 28.5 bits (62), Expect = 7.2 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = +3 Query: 54 QPYVIT*FQPPTDLKEPINDPNRTHIVHEHGKKTRHKFFY 173 +PY + +PP D + RT + E GK TRH F+ Sbjct: 45 KPYFLGEVKPPFDRATSVQKCVRTPDIEEVGKTTRHGTFF 84
>LTBP1_RAT (Q00918) Latent transforming growth factor beta-binding protein 1| precursor (LTBP-1) (Transforming growth factor beta-1-binding protein 1) (TGF-beta-1-BP-1) (Transforming growth factor beta-1-masking protein, large subunit) Length = 1712 Score = 28.5 bits (62), Expect = 7.2 Identities = 16/44 (36%), Positives = 22/44 (50%) Frame = +1 Query: 169 SISHPPKVC*NLHDCCLQNTACPSHSRVVLLIFCNNAHDLVRCV 300 SIS + C ++ D C+ NT C SH FC+N RC+ Sbjct: 1226 SISADGRTCEDI-DECVNNTVCDSHG------FCDNTAGSFRCL 1262
>LTB1L_MOUSE (Q8CG19) Latent transforming growth factor beta-binding protein,| isoform 1L precursor (LTBP-1) (Transforming growth factor beta-1-binding protein 1) (TGF-beta1-BP-1) Length = 1713 Score = 28.5 bits (62), Expect = 7.2 Identities = 16/44 (36%), Positives = 22/44 (50%) Frame = +1 Query: 169 SISHPPKVC*NLHDCCLQNTACPSHSRVVLLIFCNNAHDLVRCV 300 SIS + C ++ D C+ NT C SH FC+N RC+ Sbjct: 1227 SISADGRTCEDI-DECVNNTVCDSHG------FCDNTAGSFRCL 1263
>LTB1L_HUMAN (Q14766) Latent transforming growth factor beta-binding protein,| isoform 1L precursor (LTBP-1) (Transforming growth factor beta-1-binding protein 1) (TGF-beta1-BP-1) Length = 1595 Score = 28.5 bits (62), Expect = 7.2 Identities = 16/44 (36%), Positives = 22/44 (50%) Frame = +1 Query: 169 SISHPPKVC*NLHDCCLQNTACPSHSRVVLLIFCNNAHDLVRCV 300 SIS + C ++ D C+ NT C SH FC+N RC+ Sbjct: 1108 SISADGRTCEDI-DECVNNTVCDSHG------FCDNTAGSFRCL 1144 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 62,599,698 Number of Sequences: 219361 Number of extensions: 1245987 Number of successful extensions: 2599 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 2562 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2598 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2453576370 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)