Clone Name | rbart21c03 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | POLB_CHPVU (Q9YTU2) ORFB polyprotein [Contains: Papain-like prot... | 34 | 0.20 | 2 | POLB_CHPVE (Q04350) ORFB polyprotein [Contains: Papain-like prot... | 33 | 0.34 | 3 | CD72_HUMAN (P21854) B-cell differentiation antigen CD72 (Lyb-2) | 30 | 3.8 |
---|
>POLB_CHPVU (Q9YTU2) ORFB polyprotein [Contains: Papain-like protease p48 (EC| 3.4.22.-); Putative RNA-directed RNA polymerase/Helicase (EC 2.7.7.48) (EC 3.6.1.-)] Length = 3164 Score = 34.3 bits (77), Expect = 0.20 Identities = 13/28 (46%), Positives = 20/28 (71%) Frame = +2 Query: 89 RDIVLHSRRVITEHPYFQKQANKKMQNR 172 RD+V+H R+IT HPY ++ N++ NR Sbjct: 2896 RDVVVHKGRLITPHPYTDEKTNEQRVNR 2923
>POLB_CHPVE (Q04350) ORFB polyprotein [Contains: Papain-like protease p48 (EC| 3.4.22.-); Putative RNA-directed RNA polymerase/Helicase (EC 2.7.7.48) (EC 3.6.1.-)] Length = 3165 Score = 33.5 bits (75), Expect = 0.34 Identities = 11/28 (39%), Positives = 20/28 (71%) Frame = +2 Query: 89 RDIVLHSRRVITEHPYFQKQANKKMQNR 172 RD+++H R++T HPY ++ N++ NR Sbjct: 2897 RDVIVHKGRLVTPHPYTDEKTNEQRVNR 2924
>CD72_HUMAN (P21854) B-cell differentiation antigen CD72 (Lyb-2)| Length = 359 Score = 30.0 bits (66), Expect = 3.8 Identities = 15/53 (28%), Positives = 26/53 (49%) Frame = +2 Query: 266 VAHGAFFF*LLLEARGWKGVQKQVNPSGQELPPLN*CQLYPYQHSYHWARPLL 424 + H F + L ++ W+ QKQ +L + ++YP HSY++ LL Sbjct: 238 IMHQKSCFYISLTSKNWQESQKQCETLSSKLATFS--EIYPQSHSYYFLNSLL 288 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 71,829,847 Number of Sequences: 219361 Number of extensions: 1419995 Number of successful extensions: 2711 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2672 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2711 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3754426130 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)