Clone Name | rbart21b12 |
---|---|
Clone Library Name | barley_pub |
>HEXP_LEIMA (Q04832) DNA-binding protein HEXBP (Hexamer-binding protein)| Length = 271 Score = 38.9 bits (89), Expect = 0.007 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 360 CFSCGESGHFSRECPNKA 307 CF CGE GH SRECPN+A Sbjct: 45 CFRCGEEGHMSRECPNEA 62 Score = 37.7 bits (86), Expect = 0.015 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -1 Query: 360 CFSCGESGHFSRECPNKA 307 CF CGE+GH SR+CPN A Sbjct: 72 CFRCGEAGHMSRDCPNSA 89 Score = 35.8 bits (81), Expect = 0.056 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = -1 Query: 360 CFSCGESGHFSRECPN 313 C+ CGESGH SRECP+ Sbjct: 198 CYKCGESGHMSRECPS 213 Score = 34.3 bits (77), Expect = 0.16 Identities = 10/16 (62%), Positives = 14/16 (87%) Frame = -1 Query: 360 CFSCGESGHFSRECPN 313 C+ CG++GH SR+CPN Sbjct: 170 CYKCGDAGHISRDCPN 185 Score = 34.3 bits (77), Expect = 0.16 Identities = 10/16 (62%), Positives = 14/16 (87%) Frame = -1 Query: 360 CFSCGESGHFSRECPN 313 C+ CG++GH SR+CPN Sbjct: 142 CYKCGDAGHISRDCPN 157 Score = 33.5 bits (75), Expect = 0.28 Identities = 10/16 (62%), Positives = 14/16 (87%) Frame = -1 Query: 360 CFSCGESGHFSRECPN 313 C+ CGE+GH SR+CP+ Sbjct: 255 CYKCGEAGHISRDCPS 270 Score = 32.0 bits (71), Expect = 0.80 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = -1 Query: 360 CFSCGESGHFSRECP 316 C+ CG+ GH SRECP Sbjct: 224 CYKCGKPGHISRECP 238 Score = 32.0 bits (71), Expect = 0.80 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = -1 Query: 360 CFSCGESGHFSRECPN 313 C+ CG+ GH SR+CP+ Sbjct: 99 CYKCGQEGHLSRDCPS 114 Score = 30.4 bits (67), Expect = 2.3 Identities = 9/15 (60%), Positives = 13/15 (86%) Frame = -1 Query: 360 CFSCGESGHFSRECP 316 C +CG+ GH++RECP Sbjct: 18 CRNCGKEGHYARECP 32
>GAG_MPMV (P07567) Gag polyprotein (Core polyprotein) [Contains: Core protein| p10; Core phosphoprotein pp24; Core protein p12; Core protein p27; Core protein p14; Core protein p4] Length = 656 Score = 36.2 bits (82), Expect = 0.043 Identities = 15/31 (48%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Frame = -1 Query: 360 CFSCGESGHFSRECPNKAH*AAQP-VRSECP 271 CF CG+ GHF++ C AH A+P V CP Sbjct: 548 CFKCGKKGHFAKNCHEHAHNNAEPKVPGLCP 578
>GLH2_CAEEL (Q966L9) ATP-dependent RNA helicase glh-2 (EC 3.6.1.-) (Germline| helicase 2) Length = 974 Score = 35.8 bits (81), Expect = 0.056 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = -1 Query: 360 CFSCGESGHFSRECPNKA 307 CF+CGE GH S ECPN A Sbjct: 475 CFNCGEQGHRSNECPNPA 492
>GLH1_CAEEL (P34689) ATP-dependent RNA helicase glh-1 (EC 3.6.1.-) (Germline| helicase 1) Length = 763 Score = 35.8 bits (81), Expect = 0.056 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = -1 Query: 360 CFSCGESGHFSRECPNKA 307 CF+CGE GH S ECPN A Sbjct: 264 CFNCGEQGHRSNECPNPA 281
>GRP2B_ARATH (Q38896) Glycine-rich protein 2b (AtGRP2b)| Length = 201 Score = 34.3 bits (77), Expect = 0.16 Identities = 11/14 (78%), Positives = 14/14 (100%) Frame = -1 Query: 360 CFSCGESGHFSREC 319 C+SCGESGHF+R+C Sbjct: 182 CYSCGESGHFARDC 195 Score = 30.8 bits (68), Expect = 1.8 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -1 Query: 360 CFSCGESGHFSREC 319 CF CGE GH +REC Sbjct: 138 CFKCGEPGHMAREC 151
>CNBP_RAT (P62634) Cellular nucleic acid-binding protein (CNBP) (Zinc finger| protein 9) Length = 177 Score = 33.9 bits (76), Expect = 0.21 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -1 Query: 360 CFSCGESGHFSRECP 316 CF CG SGH++RECP Sbjct: 6 CFKCGRSGHWARECP 20 Score = 31.6 bits (70), Expect = 1.0 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = -1 Query: 360 CFSCGESGHFSRECPNKA 307 C+ CGESGH +REC +A Sbjct: 158 CYRCGESGHLARECTIEA 175 Score = 28.9 bits (63), Expect = 6.8 Identities = 8/14 (57%), Positives = 12/14 (85%) Frame = -1 Query: 360 CFSCGESGHFSREC 319 C+ CGESGH +++C Sbjct: 54 CYRCGESGHLAKDC 67
>CNBP_PONPY (Q5R5R5) Cellular nucleic acid-binding protein (CNBP) (Zinc finger| protein 9) Length = 177 Score = 33.9 bits (76), Expect = 0.21 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -1 Query: 360 CFSCGESGHFSRECP 316 CF CG SGH++RECP Sbjct: 6 CFKCGRSGHWARECP 20 Score = 31.6 bits (70), Expect = 1.0 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = -1 Query: 360 CFSCGESGHFSRECPNKA 307 C+ CGESGH +REC +A Sbjct: 158 CYRCGESGHLARECTIEA 175 Score = 28.9 bits (63), Expect = 6.8 Identities = 8/14 (57%), Positives = 12/14 (85%) Frame = -1 Query: 360 CFSCGESGHFSREC 319 C+ CGESGH +++C Sbjct: 54 CYRCGESGHLAKDC 67
>CNBP_HUMAN (P62633) Cellular nucleic acid-binding protein (CNBP) (Zinc finger| protein 9) Length = 177 Score = 33.9 bits (76), Expect = 0.21 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -1 Query: 360 CFSCGESGHFSRECP 316 CF CG SGH++RECP Sbjct: 6 CFKCGRSGHWARECP 20 Score = 31.6 bits (70), Expect = 1.0 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = -1 Query: 360 CFSCGESGHFSRECPNKA 307 C+ CGESGH +REC +A Sbjct: 158 CYRCGESGHLARECTIEA 175 Score = 28.9 bits (63), Expect = 6.8 Identities = 8/14 (57%), Positives = 12/14 (85%) Frame = -1 Query: 360 CFSCGESGHFSREC 319 C+ CGESGH +++C Sbjct: 54 CYRCGESGHLAKDC 67
>CNBP_MOUSE (P53996) Cellular nucleic acid-binding protein (CNBP) (Zinc finger| protein 9) Length = 178 Score = 33.9 bits (76), Expect = 0.21 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -1 Query: 360 CFSCGESGHFSRECP 316 CF CG SGH++RECP Sbjct: 6 CFKCGRSGHWARECP 20 Score = 31.6 bits (70), Expect = 1.0 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = -1 Query: 360 CFSCGESGHFSRECPNKA 307 C+ CGESGH +REC +A Sbjct: 159 CYRCGESGHLARECTIEA 176 Score = 28.9 bits (63), Expect = 6.8 Identities = 8/14 (57%), Positives = 12/14 (85%) Frame = -1 Query: 360 CFSCGESGHFSREC 319 C+ CGESGH +++C Sbjct: 54 CYRCGESGHLAKDC 67
>ZCHC5_HUMAN (Q8N8U3) Zinc finger CCHC domain-containing protein 5| Length = 475 Score = 33.9 bits (76), Expect = 0.21 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = -1 Query: 360 CFSCGESGHFSRECPNKAH*AAQ 292 C CG GHF+R+CP K H A Q Sbjct: 445 CLYCGYPGHFARDCPVKPHQALQ 467
>GRP2_NICSY (P27484) Glycine-rich protein 2| Length = 214 Score = 33.9 bits (76), Expect = 0.21 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = -1 Query: 360 CFSCGESGHFSREC 319 CF CGESGHF+R+C Sbjct: 159 CFKCGESGHFARDC 172 Score = 32.3 bits (72), Expect = 0.62 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = -1 Query: 360 CFSCGESGHFSREC 319 C+ CGE GHF+REC Sbjct: 196 CYKCGEDGHFAREC 209
>CNBP_CHICK (O42395) Cellular nucleic acid-binding protein (CNBP) (Zinc finger| protein 9) Length = 172 Score = 32.7 bits (73), Expect = 0.47 Identities = 10/15 (66%), Positives = 13/15 (86%) Frame = -1 Query: 360 CFSCGESGHFSRECP 316 CF CG +GH++RECP Sbjct: 6 CFKCGRTGHWARECP 20 Score = 31.6 bits (70), Expect = 1.0 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = -1 Query: 360 CFSCGESGHFSRECPNKA 307 C+ CGESGH +REC +A Sbjct: 153 CYRCGESGHLARECTIEA 170 Score = 28.9 bits (63), Expect = 6.8 Identities = 8/14 (57%), Positives = 12/14 (85%) Frame = -1 Query: 360 CFSCGESGHFSREC 319 C+ CGESGH +++C Sbjct: 48 CYRCGESGHLAKDC 61
>LARK_DROME (Q94901) RNA-binding protein lark| Length = 352 Score = 32.3 bits (72), Expect = 0.62 Identities = 10/15 (66%), Positives = 13/15 (86%) Frame = -1 Query: 360 CFSCGESGHFSRECP 316 C+ CG SGH+S+ECP Sbjct: 170 CYRCGRSGHWSKECP 184
>ZCHC9_HUMAN (Q8N567) Zinc finger CCHC domain-containing protein 9| Length = 271 Score = 32.3 bits (72), Expect = 0.62 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -1 Query: 360 CFSCGESGHFSRECPN 313 CF CGE GH SR CP+ Sbjct: 186 CFVCGEMGHLSRSCPD 201
>ZCHC9_MOUSE (Q8R1J3) Zinc finger CCHC domain-containing protein 9| Length = 273 Score = 32.3 bits (72), Expect = 0.62 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -1 Query: 360 CFSCGESGHFSRECPN 313 CF CGE GH SR CP+ Sbjct: 186 CFVCGEMGHLSRSCPD 201
>GIS2_YEAST (P53849) Zinc-finger protein GIS2| Length = 153 Score = 32.3 bits (72), Expect = 0.62 Identities = 10/15 (66%), Positives = 13/15 (86%) Frame = -1 Query: 360 CFSCGESGHFSRECP 316 CF+C ++GH SRECP Sbjct: 67 CFNCNQTGHISRECP 81 Score = 31.6 bits (70), Expect = 1.0 Identities = 9/16 (56%), Positives = 14/16 (87%) Frame = -1 Query: 360 CFSCGESGHFSRECPN 313 C++CG++GH SR+C N Sbjct: 118 CYTCGQAGHMSRDCQN 133 Score = 30.0 bits (66), Expect = 3.1 Identities = 8/15 (53%), Positives = 13/15 (86%) Frame = -1 Query: 360 CFSCGESGHFSRECP 316 C++C E+GH S++CP Sbjct: 137 CYNCNETGHISKDCP 151
>POLX_TOBAC (P10978) Retrovirus-related Pol polyprotein from transposon TNT| 1-94 [Includes: Protease (EC 3.4.23.-); Reverse transcriptase (EC 2.7.7.49); Endonuclease] Length = 1328 Score = 32.3 bits (72), Expect = 0.62 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = -1 Query: 360 CFSCGESGHFSRECPN 313 C++C + GHF R+CPN Sbjct: 232 CYNCNQPGHFKRDCPN 247
>GAG_HTL1M (P14077) Gag polyprotein [Contains: Major core protein p19; Major| core protein p24; Nucleic acid-binding protein p15] Length = 428 Score = 32.0 bits (71), Expect = 0.80 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -1 Query: 360 CFSCGESGHFSRECPNKAH*AAQPVRSECPL 268 CF CG++GH+SR+C +P CPL Sbjct: 356 CFRCGKAGHWSRDCTQ-----PRPPPGPCPL 381
>GAG_GALV (P21416) Gag polyprotein [Contains: Core protein p15; Core protein| p12; Core protein p30; Core protein p10] Length = 519 Score = 32.0 bits (71), Expect = 0.80 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -1 Query: 360 CFSCGESGHFSRECPNKAH 304 C C E GH++RECP K H Sbjct: 490 CAYCKEKGHWARECPRKKH 508
>GAG_HTL1C (P14076) Gag polyprotein [Contains: Major core protein p19; Major| core protein p24; Nucleic acid-binding protein p15] Length = 429 Score = 32.0 bits (71), Expect = 0.80 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -1 Query: 360 CFSCGESGHFSRECPNKAH*AAQPVRSECPL 268 CF CG++GH+SR+C +P CPL Sbjct: 357 CFRCGKAGHWSRDCTQ-----PRPPPGPCPL 382
>GAG_HTL1A (P03345) Gag polyprotein [Contains: Major core protein p19; Major| core protein p24; Nucleic acid-binding protein p15] Length = 429 Score = 32.0 bits (71), Expect = 0.80 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -1 Query: 360 CFSCGESGHFSRECPNKAH*AAQPVRSECPL 268 CF CG++GH+SR+C +P CPL Sbjct: 357 CFRCGKAGHWSRDCTQ-----PRPPPGPCPL 382
>ZCH11_HUMAN (Q5TAX3) Zinc finger CCHC domain-containing protein 11| Length = 1644 Score = 31.6 bits (70), Expect = 1.0 Identities = 16/35 (45%), Positives = 20/35 (57%), Gaps = 8/35 (22%) Frame = -1 Query: 360 CFSCGESGHFSRECP--------NKAH*AAQPVRS 280 CF CG++GH RECP N + AAQ VR+ Sbjct: 1359 CFICGDAGHVRRECPEVKLARQRNSSVAAAQLVRN 1393
>RBM4_BRARE (Q6IQ97) RNA-binding protein 4 (RNA-binding motif protein 4)| Length = 419 Score = 31.6 bits (70), Expect = 1.0 Identities = 9/15 (60%), Positives = 13/15 (86%) Frame = -1 Query: 360 CFSCGESGHFSRECP 316 C+ CG+ GH+S+ECP Sbjct: 162 CYRCGQEGHWSKECP 176
>RBM4_HUMAN (Q9BWF3) RNA-binding protein 4 (RNA-binding motif protein 4)| (RNA-binding motif protein 4a) (Lark homolog) (hLark) Length = 364 Score = 31.2 bits (69), Expect = 1.4 Identities = 9/15 (60%), Positives = 13/15 (86%) Frame = -1 Query: 360 CFSCGESGHFSRECP 316 C+ CG+ GH+S+ECP Sbjct: 162 CYRCGKEGHWSKECP 176
>RBM4_BOVIN (Q3MHX3) RNA-binding protein 4 (RNA-binding motif protein 4)| (RNA-binding motif protein 4a) Length = 362 Score = 31.2 bits (69), Expect = 1.4 Identities = 9/15 (60%), Positives = 13/15 (86%) Frame = -1 Query: 360 CFSCGESGHFSRECP 316 C+ CG+ GH+S+ECP Sbjct: 162 CYRCGKEGHWSKECP 176
>RBM4B_RAT (Q64LC9) RNA-binding protein 4B (RNA-binding motif protein 4B)| (RNA-binding protein 30) (RNA-binding motif protein 30) (Zinc-responsive protein ZD7) Length = 357 Score = 31.2 bits (69), Expect = 1.4 Identities = 9/15 (60%), Positives = 13/15 (86%) Frame = -1 Query: 360 CFSCGESGHFSRECP 316 C+ CG+ GH+S+ECP Sbjct: 162 CYRCGKEGHWSKECP 176
>RBM4B_MOUSE (Q8VE92) RNA-binding protein 4B (RNA-binding motif protein 4B)| (RNA-binding protein 30) (RNA-binding motif protein 30) Length = 357 Score = 31.2 bits (69), Expect = 1.4 Identities = 9/15 (60%), Positives = 13/15 (86%) Frame = -1 Query: 360 CFSCGESGHFSRECP 316 C+ CG+ GH+S+ECP Sbjct: 162 CYRCGKEGHWSKECP 176
>RBM4_RABIT (Q9BDY9) RNA-binding protein 4 (RNA-binding motif protein 4) (Lark| homolog) Length = 359 Score = 31.2 bits (69), Expect = 1.4 Identities = 9/15 (60%), Positives = 13/15 (86%) Frame = -1 Query: 360 CFSCGESGHFSRECP 316 C+ CG+ GH+S+ECP Sbjct: 162 CYRCGKEGHWSKECP 176
>RBM4B_HUMAN (Q9BQ04) RNA-binding protein 4B (RNA-binding motif protein 4B)| (RNA-binding protein 30) (RNA-binding motif protein 30) Length = 359 Score = 31.2 bits (69), Expect = 1.4 Identities = 9/15 (60%), Positives = 13/15 (86%) Frame = -1 Query: 360 CFSCGESGHFSRECP 316 C+ CG+ GH+S+ECP Sbjct: 162 CYRCGKEGHWSKECP 176
>RBM4_MOUSE (Q8C7Q4) RNA-binding protein 4 (RNA-binding motif protein 4)| (RNA-binding motif protein 4a) (Lark homolog) (mLark) Length = 361 Score = 31.2 bits (69), Expect = 1.4 Identities = 9/15 (60%), Positives = 13/15 (86%) Frame = -1 Query: 360 CFSCGESGHFSRECP 316 C+ CG+ GH+S+ECP Sbjct: 162 CYRCGKEGHWSKECP 176
>COAT_SOCMV (P15627) Coat protein| Length = 441 Score = 31.2 bits (69), Expect = 1.4 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = -1 Query: 360 CFSCGESGHFSRECPNKAH*AAQPVR 283 C+ C E GH++ ECP K + AQ ++ Sbjct: 383 CWLCHEEGHYANECPKKDNKKAQTLK 408
>GAG_BLVJ (P03344) Gag polyprotein [Contains: Core protein p15 (Matrix| protein); Core protein p24; Core protein p12] Length = 391 Score = 31.2 bits (69), Expect = 1.4 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -1 Query: 360 CFSCGESGHFSRECPNKAH*AAQPVRSECPL 268 C+ C + GH++R+CP K A P CP+ Sbjct: 346 CYRCLKEGHWARDCPTK---ATGPPPGPCPI 373
>GAG_HTLV2 (P03346) Gag polyprotein [Contains: Core protein p15 (p19); Core| protein p24; Core protein p12 (p15)] Length = 432 Score = 30.8 bits (68), Expect = 1.8 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = -1 Query: 360 CFSCGESGHFSRECPNKAH*AAQPVRSECPL 268 CF CG+ GH+SR+C +P CPL Sbjct: 362 CFRCGKVGHWSRDCTQ-----PRPPPGPCPL 387
>COAT_FMVD (P09519) Probable coat protein| Length = 489 Score = 30.4 bits (67), Expect = 2.3 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = -1 Query: 360 CFSCGESGHFSRECPNK 310 C+ C E GH++ ECPN+ Sbjct: 411 CWICTEEGHYANECPNR 427
>GAG_RSVP (P03322) Gag polyprotein [Contains: Core protein p19; Core protein| p2A; Core protein p2B; Core protein p10; Capsid protein p27; Inner coat protein p12; Protease p15 (EC 3.4.23.-)] Length = 701 Score = 30.0 bits (66), Expect = 3.1 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -1 Query: 360 CFSCGESGHFSRECPNK 310 C++CG GH+ +CP K Sbjct: 509 CYTCGSPGHYQAQCPKK 525
>GAG_MMTVC (P11284) Gag polyprotein [Contains: Protein p10; Phosphorylated| protein pp21; Protein p3; Protein p8; Protein n; Major core protein p27; Nucleic acid-binding protein p14] Length = 590 Score = 30.0 bits (66), Expect = 3.1 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = -1 Query: 360 CFSCGESGHFSREC 319 CFSCG++GH R+C Sbjct: 526 CFSCGKTGHIKRDC 539
>GAK18_HUMAN (P62690) HERV-K_22q11.23 provirus ancestral Gag polyprotein (Gag| polyprotein) [Contains: Matrix protein; Capsid protein; Nucleocapsid protein] Length = 622 Score = 30.0 bits (66), Expect = 3.1 Identities = 12/30 (40%), Positives = 18/30 (60%), Gaps = 2/30 (6%) Frame = -1 Query: 360 CFSCGESGHFSRECP--NKAH*AAQPVRSE 277 C++CG+ GH R CP NK + Q + S+ Sbjct: 592 CYNCGQIGHLKRSCPGLNKQNIINQAINSK 621
>GAG_SRV1 (P04022) Gag polyprotein (Core polyprotein) [Contains: Core protein| p10; Core phosphoprotein pp18; Core protein p12; Core protein p27; Core protein p14; Core protein p4] Length = 657 Score = 30.0 bits (66), Expect = 3.1 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -1 Query: 360 CFSCGESGHFSRECPNKAH 304 CF CG GHF++ C H Sbjct: 549 CFKCGRKGHFAKNCHEHIH 567
>ZCHC6_MOUSE (Q5BLK4) Zinc finger CCHC domain-containing protein 6| Length = 1491 Score = 29.6 bits (65), Expect = 4.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -1 Query: 360 CFSCGESGHFSRECP 316 CF CG GH +ECP Sbjct: 1449 CFICGREGHIKKECP 1463
>BYR3_SCHPO (P36627) Cellular nucleic acid-binding protein homolog| Length = 179 Score = 29.6 bits (65), Expect = 4.0 Identities = 9/14 (64%), Positives = 13/14 (92%) Frame = -1 Query: 360 CFSCGESGHFSREC 319 C++CGE+GH +REC Sbjct: 19 CYNCGENGHQAREC 32 Score = 29.3 bits (64), Expect = 5.2 Identities = 8/16 (50%), Positives = 13/16 (81%) Frame = -1 Query: 360 CFSCGESGHFSRECPN 313 C++CG +GH R+CP+ Sbjct: 60 CYACGTAGHLVRDCPS 75
>GAG_SIVVT (P05892) Gag polyprotein [Contains: Core protein p17; Core protein| p24; Core protein p15] Length = 519 Score = 29.6 bits (65), Expect = 4.0 Identities = 10/29 (34%), Positives = 18/29 (62%) Frame = -1 Query: 360 CFSCGESGHFSRECPNKAH*AAQPVRSEC 274 C++CG+ GH R+CP +P +++C Sbjct: 399 CYNCGKFGHMQRQCP-------EPRKTKC 420
>ZCHC6_HUMAN (Q5VYS8) Zinc finger CCHC domain-containing protein 6| Length = 1495 Score = 29.6 bits (65), Expect = 4.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -1 Query: 360 CFSCGESGHFSRECP 316 CF CG GH +ECP Sbjct: 1453 CFICGREGHIKKECP 1467
>GAG_SRV2 (P51516) Gag polyprotein (Core polyprotein) [Contains: Core protein| p10; Core phosphoprotein pp18; Core protein p12; Core protein p27; Core protein p14; Core protein p4] Length = 653 Score = 29.6 bits (65), Expect = 4.0 Identities = 8/14 (57%), Positives = 12/14 (85%) Frame = -1 Query: 360 CFSCGESGHFSREC 319 CF CG+ GHF+++C Sbjct: 545 CFKCGKKGHFAKDC 558
>POL_COYMV (P19199) Putative polyprotein [Contains: Coat protein; Protease (EC| 3.4.23.-); Reverse transcriptase (EC 2.7.7.49); Ribonuclease H (EC 3.1.26.4)] Length = 1886 Score = 29.6 bits (65), Expect = 4.0 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 360 CFSCGESGHFSRECPNK 310 C+ CG+ GH++ +C NK Sbjct: 881 CYICGQEGHYANQCRNK 897
>GAG_BLVAU (P25058) Gag polyprotein [Contains: Core protein p15 (Matrix| protein); Core protein p24; Core protein p12] Length = 391 Score = 29.6 bits (65), Expect = 4.0 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = -1 Query: 360 CFSCGESGHFSRECPNKAH*AAQPVRSECPL 268 C+ C + GH++R+CP K P CP+ Sbjct: 346 CYRCLKEGHWARDCPTK---TTGPPPGPCPI 373
>GAG_IPMA (P11365) Retrovirus-related Gag polyprotein [Contains: Protease (EC| 3.4.23.-)] Length = 827 Score = 29.3 bits (64), Expect = 5.2 Identities = 8/14 (57%), Positives = 12/14 (85%) Frame = -1 Query: 360 CFSCGESGHFSREC 319 CF+CG+ GHF ++C Sbjct: 460 CFNCGKPGHFKKDC 473
>GAG_SIVVG (P27978) Gag polyprotein [Contains: Core protein p17; Core protein| p24; Core protein p15] Length = 521 Score = 29.3 bits (64), Expect = 5.2 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = -1 Query: 360 CFSCGESGHFSRECP 316 C++CG+ GH R+CP Sbjct: 404 CYNCGKFGHMQRQCP 418
>GLH4_CAEEL (O76743) ATP-dependent RNA helicase glh-4 (EC 3.6.1.-) (Germline| helicase 4) Length = 1156 Score = 29.3 bits (64), Expect = 5.2 Identities = 8/17 (47%), Positives = 14/17 (82%) Frame = -1 Query: 360 CFSCGESGHFSRECPNK 310 C +CG+ GHF+++C N+ Sbjct: 641 CRNCGQEGHFAKDCQNE 657 Score = 28.9 bits (63), Expect = 6.8 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = -1 Query: 360 CFSCGESGHFSREC 319 C +CGE GH S+EC Sbjct: 572 CHNCGEEGHISKEC 585
>GAG_SIVV1 (P27972) Gag polyprotein [Contains: Core protein p17; Core protein| p24; Core protein p15] Length = 520 Score = 29.3 bits (64), Expect = 5.2 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = -1 Query: 360 CFSCGESGHFSRECP 316 C++CG+ GH R+CP Sbjct: 400 CYNCGKFGHMQRQCP 414
>ZCHC2_MOUSE (Q69ZB8) Zinc finger CCHC domain-containing protein 2 (Fragment)| Length = 1168 Score = 28.9 bits (63), Expect = 6.8 Identities = 13/36 (36%), Positives = 21/36 (58%), Gaps = 4/36 (11%) Frame = -1 Query: 360 CFSCGESGHFSRECPNKAH*AAQP----VRSECPLP 265 C++CG SGH++++C + A Q +R PLP Sbjct: 1123 CYNCGVSGHYAQDCKQSSMEANQQGTYRLRYAPPLP 1158
>GAG_MMTVB (P10258) Gag polyprotein [Contains: Protein p10; Phosphorylated| protein pp21; Protein p3; Protein p8; Protein n; Major core protein p27; Nucleic acid-binding protein p14] Length = 590 Score = 28.9 bits (63), Expect = 6.8 Identities = 8/17 (47%), Positives = 14/17 (82%) Frame = -1 Query: 360 CFSCGESGHFSRECPNK 310 CFSCG++GH ++C ++ Sbjct: 526 CFSCGKTGHIRKDCKDE 542
>ZCHC2_HUMAN (Q9C0B9) Zinc finger CCHC domain-containing protein 2 (Fragment)| Length = 899 Score = 28.9 bits (63), Expect = 6.8 Identities = 13/36 (36%), Positives = 21/36 (58%), Gaps = 4/36 (11%) Frame = -1 Query: 360 CFSCGESGHFSRECPNKAH*AAQP----VRSECPLP 265 C++CG SGH++++C + A Q +R PLP Sbjct: 854 CYNCGVSGHYAQDCKQSSMEANQQGTYRLRYAPPLP 889
>GAK8_HUMAN (Q9HDB9) HERV-K_3q12.3 provirus ancestral Gag polyprotein (Gag| polyprotein) (HERV-K(II) Gag protein) [Contains: Matrix protein; Capsid protein; Nucleocapsid protein] Length = 666 Score = 28.9 bits (63), Expect = 6.8 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -1 Query: 360 CFSCGESGHFSRECP 316 C++CG+ GH R CP Sbjct: 544 CYNCGQIGHLKRSCP 558
>GAG_SIVG1 (Q02843) Gag polyprotein [Contains: Core protein p17; Core protein| p24; Core protein p15] Length = 513 Score = 28.9 bits (63), Expect = 6.8 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = -1 Query: 360 CFSCGESGHFSREC 319 CF+CG+ GH REC Sbjct: 392 CFNCGKFGHMQREC 405 Score = 28.5 bits (62), Expect = 8.9 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = -1 Query: 360 CFSCGESGHFSRECPN 313 CF CG+ GH +++C N Sbjct: 413 CFKCGKIGHMAKDCKN 428
>RBBP6_HUMAN (Q7Z6E9) Retinoblastoma-binding protein 6 (p53-associated cellular| protein of testis) (Proliferation potential-related protein) (Protein P2P-R) (Retinoblastoma-binding Q protein 1) (Protein RBQ-1) Length = 1792 Score = 28.5 bits (62), Expect = 8.9 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -1 Query: 360 CFSCGESGHFSRECP 316 CF CG+ GH+ + CP Sbjct: 161 CFRCGKPGHYIKNCP 175
>MSL5_YEAST (Q12186) Branchpoint-bridging protein MSL5 (MUD synthesis lethal 5| protein) Length = 476 Score = 28.5 bits (62), Expect = 8.9 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = -1 Query: 360 CFSCGESGHFSREC 319 C CG++GHFSR+C Sbjct: 299 CKICGQTGHFSRDC 312
>RBBP6_MOUSE (P97868) Retinoblastoma-binding protein 6 (p53-associated cellular| protein of testis) (Proliferation potential-related protein) (Protein P2P-R) Length = 1790 Score = 28.5 bits (62), Expect = 8.9 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -1 Query: 360 CFSCGESGHFSRECP 316 CF CG+ GH+ + CP Sbjct: 162 CFRCGKPGHYIKNCP 176
>ZCHC7_HUMAN (Q8N3Z6) Zinc finger CCHC domain-containing protein 7| Length = 542 Score = 28.5 bits (62), Expect = 8.9 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = -1 Query: 360 CFSCGESGHFSRECPNK 310 C+ C + GH+ ECP + Sbjct: 349 CYHCAQKGHYGHECPER 365 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 38,977,807 Number of Sequences: 219361 Number of extensions: 565134 Number of successful extensions: 1516 Number of sequences better than 10.0: 58 Number of HSP's better than 10.0 without gapping: 1322 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1515 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3014947676 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)