Clone Name | rbart21a08 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | YL86_CAEEL (P34444) Hypothetical protein F54C8.6 | 30 | 4.1 | 2 | YKR5_CAEEL (P34311) Probable G-protein coupled receptor C06G4.5 | 29 | 7.1 | 3 | TLR8_HUMAN (Q9NR97) Toll-like receptor 8 precursor | 29 | 7.1 | 4 | MFRN1_BOVIN (Q3ZBJ8) Mitoferrin-1 (Mitochondrial iron transporte... | 29 | 7.1 |
---|
>YL86_CAEEL (P34444) Hypothetical protein F54C8.6| Length = 265 Score = 30.0 bits (66), Expect = 4.1 Identities = 22/75 (29%), Positives = 34/75 (45%), Gaps = 2/75 (2%) Frame = +2 Query: 116 LSISYNESTIARDLTCGIAATCHALWDG*SSNLAFGQTVIASIEVTFLHLAETYG--INH 289 ++IS TI++ T A+W G S N+ FG F L E G INH Sbjct: 172 ITISEFFQTISKGFTV-FGTLFTAIWHGLSENVFFG----------FHELGENLGENINH 220 Query: 290 HIMYTIRFFHAFTNI 334 + + ++FFH ++ Sbjct: 221 LLHFVVQFFHQIIHL 235
>YKR5_CAEEL (P34311) Probable G-protein coupled receptor C06G4.5| Length = 436 Score = 29.3 bits (64), Expect = 7.1 Identities = 12/33 (36%), Positives = 21/33 (63%), Gaps = 2/33 (6%) Frame = +2 Query: 296 MYTIRFFHA--FTNIDVNWLNHAPIHGLIEQFY 388 +Y + F HA FTN +NW+ + ++G ++Q Y Sbjct: 318 VYIMYFIHALPFTNSAINWILYGALNGQLQQRY 350
>TLR8_HUMAN (Q9NR97) Toll-like receptor 8 precursor| Length = 1041 Score = 29.3 bits (64), Expect = 7.1 Identities = 20/69 (28%), Positives = 34/69 (49%), Gaps = 4/69 (5%) Frame = +2 Query: 227 TVIASIEVTFL----HLAETYGINHHIMYTIRFFHAFTNIDVNWLNHAPIHGLIEQFYHR 394 T ++ +EV L H G+ HH+ F FTN+ V L+H I+ L +++ Sbjct: 551 TELSDLEVLDLSYNSHYFRIAGVTHHL----EFIQNFTNLKVLNLSHNNIYTLTDKYNLE 606 Query: 395 AQTC*SLVF 421 +++ LVF Sbjct: 607 SKSLVELVF 615
>MFRN1_BOVIN (Q3ZBJ8) Mitoferrin-1 (Mitochondrial iron transporter 1) (Solute| carrier family 25 member 37) Length = 171 Score = 29.3 bits (64), Expect = 7.1 Identities = 17/71 (23%), Positives = 28/71 (39%) Frame = +2 Query: 260 HLAETYGINHHIMYTIRFFHAFTNIDVNWLNHAPIHGLIEQFYHRAQTC*SLVFHDKQNL 439 H YG I+ T F+ ++V + P H + Y + + VFH + N Sbjct: 83 HYTSVYGALKKIIRTEGFWRPLRGLNVMMMGAGPAHAMYFACYENMKRTLNAVFHHQGNS 142 Query: 440 KLSTYISXELA 472 L+ I L+ Sbjct: 143 HLANGICKRLS 153 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 67,732,437 Number of Sequences: 219361 Number of extensions: 1276577 Number of successful extensions: 2731 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2691 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2731 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4085413911 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)