Clone Name | rbart20h05 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | TOM1_ASHGO (Q756G2) Probable E3 ubiquitin protein ligase TOM1 (E... | 28 | 9.9 |
---|
>TOM1_ASHGO (Q756G2) Probable E3 ubiquitin protein ligase TOM1 (EC 6.3.2.-)| Length = 3258 Score = 28.1 bits (61), Expect = 9.9 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = -3 Query: 122 SVDDGLSNAIPILLFARTLGFCIYRGLLLSMPT 24 ++ DG+ +P LF + GF IY L+ + T Sbjct: 1033 TISDGIVQTVPTFLFYQAGGFAIYHELIKKLST 1065 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 51,225,694 Number of Sequences: 219361 Number of extensions: 915794 Number of successful extensions: 2208 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 2178 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2208 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2570413340 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)