Clone Name | rbart20g10 |
---|---|
Clone Library Name | barley_pub |
>NUOF2_RHIME (P56913) NADH-quinone oxidoreductase chain F 2 (EC 1.6.99.5) (NADH| dehydrogenase I, chain F 2) (NDH-1, chain F 2) Length = 421 Score = 31.2 bits (69), Expect = 1.3 Identities = 27/106 (25%), Positives = 40/106 (37%) Frame = +1 Query: 16 YFMGKILAMVELLSVHSLQP*NKNELTDPNFFKIKGKRVDQIALCVFTK*NVLKNPSYFR 195 Y G+ AM+E L QP K ++ + V++ ++FR Sbjct: 169 YICGEETAMLESLEGKRAQPRLKPPFPAVAGLYASPTVINNVETLACVPHIVMRGSAWFR 228 Query: 196 GSGAPRKPVPQRFGRSGDIRPAVLRRERIQA*ARALVLHHPFRPPP 333 G G R P P+ + SG +R L + R LV H P P Sbjct: 229 GIGPDRSPGPKLYCLSGQVRKPGLYELPMGISLRELVEEHAGGPLP 274
>MASS1_BRARE (Q6JAN0) Monogenic audiogenic seizure susceptibility protein 1| homolog precursor (Very large G-protein coupled receptor 1) Length = 6199 Score = 29.3 bits (64), Expect = 4.9 Identities = 15/33 (45%), Positives = 18/33 (54%) Frame = +2 Query: 185 PILEEAEPHESRFRSGSDAQVTSGRPCCDGSES 283 P E +PH R +G+DA SGRP GS S Sbjct: 1300 PSAVELQPHSRRRHAGTDALFFSGRPGAYGSIS 1332
>TF7L2_HUMAN (Q9NQB0) Transcription factor 7-like 2 (HMG box transcription| factor 4) (T-cell-specific transcription factor 4) (TCF-4) (hTCF-4) Length = 619 Score = 28.5 bits (62), Expect = 8.4 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = +2 Query: 170 CLKIPPILEEAEPHESRFRSGSDAQVTSGRPC 265 CL +PPI + + P + R R G D Q PC Sbjct: 449 CLSLPPITDLSAPKKCRARFGLDQQNNWCGPC 480
>6PGD_SHEEP (P00349) 6-phosphogluconate dehydrogenase, decarboxylating (EC| 1.1.1.44) Length = 482 Score = 28.5 bits (62), Expect = 8.4 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +2 Query: 194 EEAEPHESRFRSGSDAQVTSGRPCCD 271 +EA PH G A+V +G PCCD Sbjct: 146 KEAWPHIKAIFQGIAAKVGTGEPCCD 171
>6PGD_HUMAN (P52209) 6-phosphogluconate dehydrogenase, decarboxylating (EC| 1.1.1.44) Length = 482 Score = 28.5 bits (62), Expect = 8.4 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +2 Query: 194 EEAEPHESRFRSGSDAQVTSGRPCCD 271 +EA PH G A+V +G PCCD Sbjct: 146 KEAWPHIKTIFQGIAAKVGTGEPCCD 171
>TF7L2_MOUSE (Q924A0) Transcription factor 7-like 2 (HMG box transcription| factor 4) (T-cell-specific transcription factor 4) (TCF-4) (mTCF-4) Length = 459 Score = 28.5 bits (62), Expect = 8.4 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = +2 Query: 170 CLKIPPILEEAEPHESRFRSGSDAQVTSGRPC 265 CL +PPI + + P + R R G D Q PC Sbjct: 426 CLSLPPITDLSAPKKCRARFGLDQQNNWCGPC 457 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52,159,319 Number of Sequences: 219361 Number of extensions: 872482 Number of successful extensions: 2049 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1978 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2049 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2851757076 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)