ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbart20g05 |
|---|---|
| Clone Library Name | barley_pub |
>CBB1_CARPI (P38579) Bacteriocin carnobacteriocin BM1 precursor| (Carnobacteriocin B1) Length = 61 Score = 29.6 bits (65), Expect = 1.9 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = +2 Query: 38 YPNHLYTRQDICWVNKGSNKKFVS 109 Y N +Y ++ CWVNK NK+ ++ Sbjct: 22 YGNGVYCNKEKCWVNKAENKQAIT 45
>ARCA_VIBVY (Q7MHF3) Arginine deiminase (EC 3.5.3.6) (ADI) (Arginine| dihydrolase) (AD) Length = 406 Score = 29.3 bits (64), Expect = 2.5 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = +2 Query: 29 VQKYPNHLYTRQDICWVNKG 88 ++ PNHL+TR CWV G Sbjct: 147 IEPLPNHLFTRDTSCWVYGG 166
>ARCA_VIBVU (Q8DCF4) Arginine deiminase (EC 3.5.3.6) (ADI) (Arginine| dihydrolase) (AD) Length = 406 Score = 29.3 bits (64), Expect = 2.5 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = +2 Query: 29 VQKYPNHLYTRQDICWVNKG 88 ++ PNHL+TR CWV G Sbjct: 147 IEPLPNHLFTRDTSCWVYGG 166
>ARCA_VIBPA (Q87LG0) Arginine deiminase (EC 3.5.3.6) (ADI) (Arginine| dihydrolase) (AD) Length = 407 Score = 29.3 bits (64), Expect = 2.5 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = +2 Query: 29 VQKYPNHLYTRQDICWVNKG 88 ++ PNHL+TR CWV G Sbjct: 147 IEPLPNHLFTRDTSCWVYGG 166
>ARCA_SALTY (Q8ZK33) Arginine deiminase (EC 3.5.3.6) (ADI) (Arginine| dihydrolase) (AD) Length = 406 Score = 28.9 bits (63), Expect = 3.3 Identities = 11/22 (50%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = +2 Query: 26 FVQK-YPNHLYTRQDICWVNKG 88 F+ K PNHL+TR CW+ G Sbjct: 145 FIMKPLPNHLFTRDTSCWIYNG 166
>ARCA_SALTI (Q8Z125) Arginine deiminase (EC 3.5.3.6) (ADI) (Arginine| dihydrolase) (AD) Length = 406 Score = 28.9 bits (63), Expect = 3.3 Identities = 11/22 (50%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = +2 Query: 26 FVQK-YPNHLYTRQDICWVNKG 88 F+ K PNHL+TR CW+ G Sbjct: 145 FIMKPLPNHLFTRDTSCWIYNG 166
>ARCA2_ECOL6 (Q8FAD9) Arginine deiminase (EC 3.5.3.6) (ADI) (Arginine| dihydrolase) (AD) Length = 407 Score = 28.9 bits (63), Expect = 3.3 Identities = 11/22 (50%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = +2 Query: 26 FVQK-YPNHLYTRQDICWVNKG 88 F+ K PNHL+TR CW+ G Sbjct: 146 FIMKPLPNHLFTRDTSCWIYNG 167
>GAP2_CAEEL (Q8MLZ5) Ras GTPase-activating protein gap-2 (GTPase-activating| protein 2) Length = 1207 Score = 28.5 bits (62), Expect = 4.3 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -3 Query: 339 PEVMMN*LVSVPCHVTSCVVSGEVTILCCYLMEY 238 P MMN V +P H CV + + CY EY Sbjct: 54 PTKMMNKEVKLPWHAGYCVFEPRQSTMSCYKQEY 87
>RL18_ASTYP (Q847S1) 50S ribosomal protein L18| Length = 114 Score = 28.5 bits (62), Expect = 4.3 Identities = 14/32 (43%), Positives = 17/32 (53%) Frame = +1 Query: 43 KSLVYKTGYLLGKQRKQQKVCKFKLNMHGYYY 138 K L YK G LLGK K + K + +GY Y Sbjct: 65 KELSYKIGNLLGKIIKSYGISKILFDRNGYIY 96
>GP110_HUMAN (Q5T601) Probable G-protein coupled receptor 110 precursor| (G-protein coupled receptor PGR19) (G-protein coupled receptor KPG_012) Length = 911 Score = 27.3 bits (59), Expect = 9.5 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = +2 Query: 41 PNHLYTRQDICWVNKGSNKK 100 P++ Y R+D+CW+N + K Sbjct: 724 PSNTYKRKDVCWLNWSNGSK 743 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45,650,979 Number of Sequences: 219361 Number of extensions: 744101 Number of successful extensions: 1343 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1332 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1343 length of database: 80,573,946 effective HSP length: 91 effective length of database: 60,612,095 effective search space used: 1454690280 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
