| Clone Name | rbart20g04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | STR3_SCHPO (Q92341) Siderophore iron transporter 3 | 28 | 9.2 |
|---|
>STR3_SCHPO (Q92341) Siderophore iron transporter 3| Length = 630 Score = 28.5 bits (62), Expect = 9.2 Identities = 15/35 (42%), Positives = 21/35 (60%) Frame = -2 Query: 353 LVGIFYFIGFGLFALESLLSIWVIQQVYMYFRGSG 249 LV +FY IGF + A S +S +VI V++ SG Sbjct: 155 LVLLFYVIGFIVVASSSTISAYVIGSVFISIGSSG 189 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 69,064,540 Number of Sequences: 219361 Number of extensions: 1421679 Number of successful extensions: 3187 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 3118 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3187 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3130907202 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)