| Clone Name | rbart20d10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YQAT_BACSU (P45916) Hypothetical protein yqaT (ORF50) | 28 | 5.0 | 2 | XTMB_BACSU (P39786) PBSX phage terminase large subunit | 28 | 8.6 |
|---|
>YQAT_BACSU (P45916) Hypothetical protein yqaT (ORF50)| Length = 431 Score = 28.5 bits (62), Expect = 5.0 Identities = 11/33 (33%), Positives = 20/33 (60%) Frame = +1 Query: 19 HQKDIIVIINTYFHQHHGKIKLFMPSTYLANID 117 ++K IIV +TY+H LF+P +Y+ ++ Sbjct: 181 YEKRIIVSNDTYYHHSTADDNLFLPESYVQQLE 213
>XTMB_BACSU (P39786) PBSX phage terminase large subunit| Length = 433 Score = 27.7 bits (60), Expect = 8.6 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = +1 Query: 19 HQKDIIVIINTYFHQHHGKIKLFMPSTYLANID 117 ++K IV +TY+H LF+P +Y+ +D Sbjct: 182 YEKRTIVKGDTYYHHSTANDNLFLPESYVKQLD 214 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 30,734,343 Number of Sequences: 219361 Number of extensions: 466529 Number of successful extensions: 1058 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1050 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1058 length of database: 80,573,946 effective HSP length: 44 effective length of database: 70,922,062 effective search space used: 1702129488 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)